The URL can be used to link to this page

CP 2018-11-13 !"#"$ %&' () *+,,*- . /&+ (+ -0-121+( 33+ .*+ . # 4'131/+0)('4 5 .&3&-6' &%(+** 7 8 +%'* 6 ! 9 & 1 ::' !1 4;1 99 &1 9 8 ::9 #': ;9/! : <1 ":8"=#>.! ! ' !1 ; ! : ! ! 4;1 ' !1 ? : 9 ": - #:' !1 = >", & 1 ":8".! 2 9 : : !!" "!#"!$!! ! %"&%" %!#'"( "&"! " & 1 ":$8.! 2' 6! : !"#"$ /:)"&" %" %& ("& ( ! &! !# '$"" ! ') ! 1 ":8#.! 26 & : :)"&" %" % ! &! !# '!!*" ! '+ !#!*" : 4;1 =- >", & $ )"&" %" % (("" $ " !( ! )"&" %" % ",- ( ! & )"&" %" %. ' & "! ) )"&" %" %$! !# %/0 )"&" %" %$% 1!( - $% (( ' . ' & "!(( ' &1 =- > 7: + ! 8 :: : 5: " ' &(!" (" %2 (,3 45&" "! $&"!" )6 !# "7" %!#5 ! "% &(!" ' 8: < @ $: : " '!#(" !8/&! ,3 53' /: " ' !#&# '#(1(%" %(' &# +' !" !#" %$!4"& 6' (& 1 !" 1 &!# %#, !&!2 " !#( ! '9: ,%!: !# "7" %!#"!5 %! "% & &( !!" +!''5( +$#(1(%" %(' & 1 !"; !' : " ! &#"!"%#!<=>& ?@' ($ !"" !#( ! '93,%!" ABC !"#"$ !# "7" %!#"!5 %! "% & &( ! ?5( ' ?; !' 6: " ' /" &' )D$ @A 7 !! !!&#)!"+"! ' =E'!"!# %# ! ! "!# " !" % & ' ! &!!.+ * !# "7" %!#5 ! "% 5( ' /" &' #","!)!"+"! ' #","!* & F+' #","!)"" %!" +"% ' #","!$*%)&"!" ' ': " ' " &' )D$, 5 /''"& 3) ! **7 " %&# %E!' ()D< ) ( !D"" ((&">! !!&#)!"+"! ' 33E' !,"" % & ' <* !3> &! ) ! D "(!'! !# '.+ * D : !# "7" %!#5 ! "% 5( ' /" &' #","!$*%)&"!" ' #","!)!"+"! ' #","!* & ' #","!)!" ' ,: " ' /" &' )D3GH"!D"% $"!" * !3D & )<#7>7 " %&# %E!' ( )DG< ) ( !D"" G"%# ((&">! )D3G< ) ( !D"" 3G"%# ((&">! ( !# ) ( !! !!&# )!"+"! ! =E' !("&,"" % 3 & ' ! &! !# '!# !# !& '+G 7: !# "7" %!#5 ! "% 5( ' /" &' #","!$*%)&"!" ' #","!)!"+"! ' #","!* & +' #","!)!" ' #","!+"% %' !"#"$ #","!AD " %' .: " ' /" &' )DDGG ( +"!7 " %&# %E!' ()DDG< ) ( !D"" D"G"%# ((&">! )DDG< ) ( !D"" D"" G"%# ((&">! ( !# ) ( !! !!&# )!"+"! ! ("!<" &># ! 3& ' ! &! " !.! "(!'! !# ')"" )": !# "7" %!#5 ! "% 5( ' /" &' #","!$*%)&"!" ' #","!/+"! ' #","!)!" ' #","!)* & ' #","!A"!A ' #","!A"& !#A ' #","!I+"% & %' (: " ! ,"0;4+ !# ! .! D#,""!!" 6! 1 &" !#( ! '9= " ' " !#, & !# "7" %!#"!5 %! "% & &( ! D#,""!!" $ 5( ' D#,#,""!' 1 &' ",!" +#!+ !# ! +J ' *!! 'D&+"% ' "! !&!" !&!' +: " ! !" ! K&!+&"'"&$%( ! "!#) !' (" ! & "( ( !! " % " !#( ! '9,%!" !#1 '!&!5" ! & )" %L!""!)"!"&!' : !# "7" %!#"!5 %! &! & &( ! ) !+$5( "' +$"! ' ' 5!$%( !' 0: " ' & !&! "!#2 ! &!*"'!" % +!,""7!" 1 &! ' ( !!"C(K& " % %(" !#( ! '9!# %# 1 ! &%( ! "!#!#"! ' I "":,%!" !#1 '!&!5" ! &A : ! !"#"$ !# "7" %!#"!5 %! "% & &( ! 2 !5( ' =3( !*" %+"&$52)3JJ' ' A:/212L)L*1G$D12I8 " ')D+AF& ,A(," %7 " % &# %E!' ()+AF< ) ( !+" % A("F>! )D+AF< ) ( !D" +" %A("F>! "!#)!"+"! "!" ! ("!!# ( ! '" %'(" ! " <>& (( ! & ' &! !# !#" '+ * D "(!'! !#! '+!'D <! >!!# E! ') ! * ( *! & ,A(*! ," % !,** M& M& F$ &"! & &"& (( ' *!!DE!" %!," % !")&(,' +!''D !)D+AF' )!"+"! ' #","!$) "!" ' ":L*1G$D12I8 " ')3D 7 " %&# %E! ' ()3D< ) ( !3D" ((&">! )3D< ) ( !3D"" ((&">! !,"#)!"+"! ' & " &! %( & ' ! &!!!# !#!& '+) ! !*" D <+) ! D >!!#E! 'H A5!1 &," % !,5!!5 5 %" " % & &"& (( ' +!''D !' +"! ' * & ' !" ' +"% & %' "":L*1G$D12I8 " ' /" &"% !" %2 !# " !G !I **D" !( !- 2 !! +&!" 3 '!# !D ( ! $,!( !$&! !# "7" %!# 5 ! "% 2 !# " !G !I G /" &5( ' 2 !# " !G !I ,"&G" %2 !"&' " !"#"$ 2 !# " !G !I /" &' "#: " '! D !" " %! $,!( ! $%( !,! !#"! ' 2 !# " !G !I ** !# "7" %!#5 ! "% 2 !# " !G !I D !" 5( $ '! G "1 ' 2 !# " !G !I D !" $ '!' $,!( !$%( !$ '!' 2 !# " !G !I D !" G "1 ' $,!( !G "1 ' ": " '! ""& !$%( !, ,! !# "! ' 2 !# " !G !I ** !# "7" %!#"! 5 %! "% 2 !# " !G !I ""& !$%( !5( $ '! G "1 ""& !$%( !$ '!' ""& !$%( !G "1 ' "7: " ' /( ",+!!( !$%( ! D (" !" '* &( !,! !#"! ' 5" +!! *!! !# "7" %!#"!5 %! "% 5+D$%( !5( ' 5+D/( ",+!!( !$%( ! D' 2 !"& '(" !" '=3*"& $%( !' ": " 'A ! # %/0 "!# +!" % !&!" ( " ( ! '9=3= !# "7" %!#"!5 %! "% & &( ! A !/0(( ' A !L " & /0' A !1 !# !& /0' A !# %/' A !*" /"1 /0D %" ' "5: " '!#& !&!' ! !& !&! ' (" %# '!#$)$" " !!F ( !" %(" !#( ! '9! AFA !&!" 9=! 2* !&!" ( &!"! !" %9:,%!" !#1 '!&! 5" ! &A : !# "7" %!#"!5 %! "% & &( ! $ +!! $5( D 3' "!$!D"I"N ' &"+!!$*"!' # !"#"$ 2*D 0"&" &' AFAD 0' 2*,"& %' AFA,"& %!"' "8: " ' $%( !,! !#"! ' </ > !&!" +"&< !&!" 5 %>' !# & !&!" 'A"+!!" 0 D & !" &" % & !&!" +"&' 9 !# "7" %!#"!5 %! "% & &( ! 5$D+!''5( ' 5$D ' !&!" I "!" ' +! A ( '$%( !' "$: " ! &#A"& <;" !>5 03 "&H &"!O!# %# 1 ! &$%( ! "!#G ! I! $ &"<GI$>" ( ! !! &9: !# "7" %!#5 ! "% +!''5( ' A"& ;" ! 333' GI$; !' )!"D !' #: " '!#*%"!"$% ' !#& (" %=!# D%*%"!"+" *%"!"$% (( ' *%"!"$% " % " !L!' #": " " !( !! !#"!@ (("" $", "!" , ' ##: & 2? ) , #: & D !,5 G ! & (" % ! #7: & !! 9 : $ )D%" 5 ,""! "!" &"((,D . G!#" "& &"((,G" 5! &!+"& &"((,5 $ !"#"$ #: 1! 9 : #5: ' !1 ? BBBBBBBBBBBBBBBBBBBBBBBB % 1( '&+,+' + ! 9 ( A !#"$BBBBBBBBBBBBB: BBBBBBBBBBBBBBBBBBBBBBBBBBBBBB -9 6 1 )/*+ -+'21'' ,-&6-*+ ' 6-' &&3*'.+1*+- ; 9 9 4 6 "AA: !99C ! =:: !! !D!! > ! D C !;C ! 2=7$> ! D : ; %% 6 =A8#> 75#2##=66"2$2&'*3E"2$282#A$A>: 1 :5 = 9 > 1 ( 7"".! = 9> 9 : 1 :8 = 9 > 1 ( 7"".! = 9> 9 : ! !"#$% &$'(' " "# $#% # # '$(&$ )*) & # '%# &$'(' " "$$' " '$+'$ $$ "$ !'&!'"!$+,'%" '&'$ '""& ! # (#%# '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # )-)'$ "&' -+, '$ "$$' " '$+'$ $$ "$ !'&!'"!$+,'%" '&'$ '""& (%% % % ! $%#&# / %# !# /,## .# 0 # 1# #& (#%)# !# # ! % 0% -, ! " !"#$% &$'(' " #$ %$& $ $ '$ "&' )) ' $ (&$ &' "" * ''" *+"$ " +'&' "!'"!& " %'& %"$ &$" $, * ''"" $ *+"$ " " $ )$&$ ! (&*$ )$&$ +$, ! $& )&- ! ! + .,- (&$ % %$ ! ! ! "$ ! (&$, /' # $ )-)'$ "&' .,- '$ +'&' "!'"!& " %'& %"$ &$" $, * ''"" $ *+"$ " (%% & & " %&$'$ 0 &$ /$ 1 ! ! " ! "#$%&' (&)*) $ #$ %$& $ $ )& $() ++ ' $ (&$ * &, -&&.)$& -* &,&.)$ /)() $#)$# & (& &, -&&.)$$& - * &,&.)$ " $ )$&$ ! (&*$ )$&$ +$, ! $& )&- ! ! + .,- (&$ % %$ ! ! ! "$ ! (&$, /' # $ +!+)& $() .,- )& /)() $#)$# & (& &, -&&.)$$& -* &,&.)$ *'' & & " %&$'$ 0 &$ "$ 0-$$ /$ 1 $ 2$ $' )$&*$ "$ $ !" " & 1& .- ! !"#$%& ' () # "# $#% # # )% #*) ++ & # '%# ' () #+, ! -)*) #")#" # &&)) #! )#%&#% -)*) #")#" )./ #&#% * -)*) #")#"' 0 *#)% - -)*) #")#"!%#%1#"23 -)*) #")#"!"#$%& ! # (#%# / #!"#&& 0' 0 *#)% && 0 '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # +,+)% #*) -+, )% ! -)*) #")#" # &&)) #! )#%&#% -)*) #")#" )./ #&#% * -)*) #")#"' 0 *#)% - -)*) #")#"!%#%1#"23 -)*) #")#"!"#$%& (&& % % ! $%#&# ! / %# !# /,## .# 0 # 1# #& (#%)# !# # ! % 0% -, 1 MEMORANDUM To: Mayor and City Council Through: Mike Land, City Manager From: Traci E. Leach, Deputy City Manager Date: November 13, 2018 Reference: Legislative Agenda 2030: Community Wellness and Enrichment; Goal 4: Residents’ Wellness and Longevity Introduction: This agenda item is a follow up from the presentation that the Living Well in Coppell committee made in September regarding the Blue Zone project. At that time, there were additional questions about the program, costs, and benefits that were best served by having a representative of the Blue Zone program present to discuss with the Council. Additionally, the Council requested additional supporting documents to provide more context to the program and better understand the potential impacts and benefits. Michael Acker, VP of Blue Zone, will be joining this discussion via conference call to answer any questions the Council may have. Legal: None. Fiscal Impact:. None. Recommendation: None. 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference: Work Session – Discussion on Workforce Transit 2030: Business Prosperity Introduction: Businesses consider numerous factors when choosing a physical location for their company, and available labor force is one of the items they take into consideration. A vast majority of the individuals that work in Coppell do not live in Coppell, and without available public transportation, businesses in Coppell struggle to keep employment positions filled. Therefore, as part of the City’s business retention efforts, staff has been evaluating options for workforce transit to help bridge this gap. Staff completed a targeted survey in June to gather data from the businesses on their needs. The overwhelming response was that the businesses and their employees would all benefit from some type of workforce transit. Businesses feel that they cannot recruit employees from other areas due to the lack of transit. And, those employees that are utilizing public transportation to transit stops outside of Coppell are currently walking in unsafe conditions from the transit stop to Coppell. Staff’s desire is to find a solution to the first-mile/last-mile connection for the businesses and employees in Coppell. Analysis: Staff met with Denton County Transit Authority to discuss potential options for a pilot program. Through a 6 – 12-month pilot program, the City will be able to gather data to evaluate long-term needs and solutions. Staff will present a proposed partnership with Lyft for the next 6 – 12-months to gather this data. A partnership with Lyft will provide the greatest flexibility without a large capital investment at this point. Before engaging in further conversations, staff wanted to confirm that City Council agrees with moving forward in this direction. Legal Review: N/A 2 Fiscal Impact: TBD Recommendation: Staff is seeking Council’s direction on next steps. ! " !"#$%& '&%( # #$ %$& $ $ (% #'( )) ' $ (&$ '&%( #*'(%# #( + '&%( ##&(#", &-./*'( (%#!'(%( #01#%2 (3(#"%2* % ("# " $ )$&$ ! '&%( #+(&*$ )$&$ +$, ! $& )&- ! ! + .,- (&$ % %$ ! ! ! "$ ! (&$, /' # $ ).)(% #'( .,- (% #( + '&%( ##&(#", &-./*'( (%#!'(%( # 01#%2 (3(#"%2* % ("# 4&& & & " %&$'$ 0 &$ "$ 0-$$ /$ 1 $ 2$ $' )$&*$ ! "$ $ " & 1& .- PROCLAMATION WHEREAS, Macario Tristan, was hired by the City of Coppell as the Chief of Police in January 2011 after serving more than 29 years with the City of Carrollton Police Department, and WHEREAS, Chief Tristan implemented several new programs and services, including the closing of the city’s jail operation, a new radio system project, the new combined dispatch center, innovative practices in hiring, training and policing, the new alcohol teen diversion program, and WHEREAS,Chief Tristan believes strongly in problem-oriented policing and servant leadership and has successfully implemented this philosophy in every bureau and department he has led, and WHEREAS,during Chief Tristan’s tenure he has shared his leadership philosophy with agencies across the United States as well as the Chinese National Police, the Swedish National Police and the Stockholm Criminology Symposium, and WHEREAS, under Chief Tristan’s leadership the Coppell Police Department has transitioned from a traditional command and control organization committed to living and serving based on the values and principles of Servant Leadership, and WHEREAS, Chief Tristan has served the citizens of Coppell with Honor, Integrity and Pride for 8 years and has been an inspirational leader and mentor to many throughout his years of service to the City of Coppell and the Coppell Police Department. NOW, THEREFORE, I, Karen Selbo Hunt, Mayor of the City of Coppell, do hereby proclaim November 30, 2018, as “MACARIO TRISTAN APPRECIATION DAY” IN WITNESS THEREOF, I have set my hand and caused the seal of the City of Coppell to be affixed this 13th day of November 2018. _____ATTEST: Karen Selbo Hunt, Mayor Christel Pettinos, City Secretary ! !"#$%& !"#' "# $#% # # (% #)( ** & # '%# ! +%,-(#% #( +%,&(#%./)% 01 ! # (#%# -1+'%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # *1*(% #)( -+, (% #( +%,&(#%./)% 01 2&& % % 3#%4()$&)%2%%&#%56 ! $%#&# 3#%2%++') &&#%( #56 / %# !# /,## .# 0 # 1# #& (#%)# ! !# # ! % 0% -, ! "#$%&'(&)*++)&, -$*#&&#'*&./#0/*'&#&11*&,)*&, 2%/#1/-*.(#'%2 3 ,#$1$4%&#$"'*)) 5 6 *"%)#&4 7 !"!#$%&&' !($%!!"%! ) *+%#,$-.$/ 0 !$1!23%!(%!($%).#, !. "% # 8 7 9 )4 7 ) & - 4 / # 8 # / : $ 7 / ; ! :: 8 98- < : : ' 7 =8 < % < / :: % < / > ? + $: / :!6 ,< 0%4 < & 7: 4%2% !(%!(2 ! +%2 +!# 2#! #, &5%%! ! # &4!# ! 4 % < / : ! 29/ > ? + $: '@ % < / 33 ::< 29/ : 5 4%2% !(%!(#,2 +%!(6#,0('(%#% 5(! 4%2% !(%!(7# !& 4%2% !(%!(#,0 %!(8 .+ %!#!% ! )2# 4 4%2% !(%!(%#.!( )2#9# 4%2% ! &5(!:#+ 29/ : $ 7/ > ? '@ 29/ 6; :: < $ 7/ 66 :: *<6 ::5: ,$ 7< *<: 7 # 7 : ' 7 # 7 : 3: !% & 2+#% !!+%!(82# 7; <57 4$=!#, %>%!(#,. # %(! ' 77 -@:#8 2 - '@0/#7 * < : < : 6: !% & 2+#% !!+%!(#, &1 +7 <.!%2% #- =!#, %>%!(#,. # %(! ' .7 )8 #. - 8:# 8 2 &177#7 * < : < : !: !% & 2+#% !!+%!(1 +7 <*+%!*#$=!#, %>%!(#,. # %(! ' 4 4 < ' :#8 ,$ &177 ! #7 * < : < : ;:0 #7#, ?+@. #! ++!%#/! 77$- 2 77 -@ : A B# : '9 87 9 ?9 -824< 8::-8= 8 7 89 : ?% !/ 4< $CD 97 : ?& '8%77) $CD 97 : 5?"4734< $CD 97 : #7 : #: !% &#,+%!#A82# 7 #8 2 ,$ #7 * #0+ < : < : -: !% &!5(+!# %#,.#, !"#,& 1*%# "#,!-!%!%2%2& #,B;C% %#,#, #% !# ! & # %#% ! !% $%!#,+ !# & D;7(#$!#, %>%!(#,%#.!(# 2# !2 #8 2 ,$ #7 * #0+ < : < : : !% &#, ++!%#/!.!(+!# 5(+!#7(#$!#, %>%!(#,%#.!(# %(!#, !2 2+!# #8 2 ,$ #7 * #0+ < : < : 4: !% & & &% !%2(+!# %#, . !(%!%!(:!2%!#,+ !# &D$ %& ! %!#,7 ! 2$# !!2%&%2#% !& #,0 %!( 8 .+ %!#!% ! )2#$!#, %>%!(#,%# .!(# %(!!2 2+!# #8 2 ,$ #7 * #0+ < : < : %: !% &2 !#2# %#, %!&:!2# %+#% !(%!%!(!##%!(%2& #, 5#!#2 !#2#% ! )2#%!!+ !# &D; %& %!#,7 ! 2$!#, %>#,%#.!(# %(!!2 2+!# #8 2 ,$ #7 * #0+ < : < : +: !% & 0?EF& #,?%4#+!# 2 #,%!(2 !#2# %#,?%*#+7 %!/@ %#,!!! 2,+ !# &D;$7(#$!#, %>%!(#,%# .!(# %(! #8 2 ,$ #7 * #0+ < : < : % #7 : !% &0 #% ! %!(## & #& #, 2#% ! &? %(!G !# 7 2##1? # %! !#, %>%!(#,. # %(! ' 4 4 < : #8 ,$ )7 < 7 : < : :0 # !#,-#!* ?!!5!2-#.# )2#9# #4 + " : 7 $ 0@ ( + #7 5: 7 9 ) 87 8 7/ 29/ !3 :: + $8 : ! / 97 @ 97 7 : * < + 98 77 : $ : 0 #7. "!#(%!(?!# % 4&< 3:%C7 7 87&< :8 %C7 74 : 3:/ / B % 8 7 7 : / /= 6 #E 8 : 4 '8 900 8 : )97 7 :& 8 8 < < 9 7 0 77 F '8 9 630! $%:. 7 $% '8 0 < 7 F$ < G3 > ? < :: 8 '8 < @ < :2 F '8 ++&7 6 A) :. 9 F4B7 F#7 8 : 9 ) #E; A ):2 ) F &479 -94 6 #E . : : 8 97 7 : +7 &< !#:. 4 : 8 &< !0 #, 7 <: 4 77 7 9 : C599$ < &< 0; ) / 9:99 < 9 8 7 08 < %77 : 8< 8 7 8 9 : 8 8 7 C5 :$ 8 < 7 888 $/C: ! $ 7 << 8 : 3: 5 ?:*4H':*4'%% ! !2%++7"%!"%! ) *+%#, :*4'%% ! !2%++7"%! ) *+%#, *!% !2%++70 !!3%!(%!( #: ' ) 8< */4 4%# 7479 -9 6 # 7:/ 8 77 ;&< : * 888:)*/4: :+-*/4G &< 3 < 7 : <8< ! 7 $< % :* 888:::$< % H/ 9/%# 8 C 4%< &< 3 :: : / 9/% # 8 7+) &7/%8 4 5 :: -: '@0/ */4 C7 7 7 < :*/47 7 + ;:* 888: :: : + 8 8 / &< 6C 4) / &< ;97<7) / &< / .4H--I / < # 7 8 : 6: &7 : & #% < / !: &7 : #@ 7 78 @ ; ; :: ! JJJJJJJJJJJJJJJJJJJJJJJJ " / ' #%/ JJJJJJJJJJJJJJJJJJJJJJJJ / !"#$% !"& !" #"$ " " '( )) % " &$" '(* +%#%!("!% "( , $+-+ ,+%#%!("!%, -+ *, "$("$+("! $.(- /, %- #"$(#"- $+ !+0 "$-$1 ("$+% "$ ,23 0!$3"$+ (4("!$+($5"!$ (!""- -%"$$( " " '"$" *$,,5% * +%#%!("!%, - #"$(6 $, &$(" '"$" )"* "$ '$+ ) ,*+ &$" # #" " &$"* -% ! " )7)($ "-( ,*+ ($ "( , $+-+ ,+%#%!("!%, -+*, "$(" $+("! $.(- /, %- #"$(#"-$+ !+0 "$-$1 ("$+% "$ ,230!$3"$+ (4("!$+($5"!$ (!" "- -%"$$( " *%% *$$-+$,,%% $ $ +!"($%(0!$("'8-- "$9 #$"%" +'(:$%"$&- %%" . $" " .+"" 1 MEMORANDUM To:Mayor and City Council From:Kevin Richardson, Fire Chief Date:November 13, 2018 Reference:Thermal Imaging Cameras for Self-Contained Breathing Apparatus equipment 2030:Sustainable City Government Introduction: The Fire Department is requesting to purchase Thermal Imaging Cameras TICs for each of their Self- Contained Breathing Apparatus “air packs.” TICs allow the firefighters to see images during zero visibility conditions while inside a structure. Currently, only the Captain of each crew carries one portable thermal imaging camera. The adding of TICs to each breathing apparatus unit would allow firefighters to assess the interior hazardous conditions, enhance the rescue of missing or trapped victims, and provide a safety feature for self-rescue if needed. Analysis: The addition of a Thermal Imaging Camera on each SCBA pack would ensure firefighter safety when operating in hazardous conditions. Purchase of MSA#10175021-SP, iTIC Thermal Imager for G1 as well as iTIC Installation with software updates for each SCBA unit would be purchased from Casco Industries, Inc. under Buyboard contract No. 524-17 in the amount of $51,450.00. Legal Review: Agenda item did not require legal review. Fiscal Impact: The agenda item is budgeted in FY 2018-19 account 01-04-09-2982. Recommendation: 2 The Fire Department recommends approval. 607 W. 62nd Street (318) 865-5107 P.O. Box 8007 SOLD TO:SHIP TO: ATTN:ATTN: PHONE:PHONE: EMAIL:EMAIL: SALES REP SALES REP REF # 189 JG1003E TERMS FREIGHT DATE FORM TYPE 30 ALLOW 10/3/2018 QUOTE ITEM LOC DESCRIPTION QTY SHIPPED PRICE AMOUNT 1 MSA # 10175021-SP; iTIC Thermal Imager for G1 -$ 50 999.00$ 49,950.00$ 5- Year Warranty -$ -$ -$ PRICE GOOD THRU DEC 7th, 2018 -$ -$ -$ CODE B91 -$ -$ -$ 2 iTIC Installation with software update.-$ 50 30.00$ 1,500.00$ -$ -$ -$ -$ -$ -$ 5- year extended warranty -$ -$ -$ $300.00 per iTIC (10 year total)-$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ DIST TOTAL:Subtotal 51,450.00$ Tax -$ Freight -$ TOTAL 51,450.00$ ADDITIONAL COMMENTS BELOW 51,450.00$ 469-878-9307 BuyBoard 524-17 TRANSACTION ID# NAME/EXP DATE NUMBER/CODE/ZIP CREDIT CARD: DIST ALLOW jessie@cascoindustries.com CUST PO NUMBER Captain Porter SERVING NORTH TEXAS Coppell Fire Department HEADQUARTERS: SHREVEPORT, LA 71148-8007 CASCO Industries 1517 W. Carrier Parkway Grand Prairie, TX 75050 Jessie Gentry "PROVIDING PROTECTION FOR THOSE WHO PROTECT US"Page 1 ! " !"#$%& !"#' #$ %$& $ $ () ** ' $ (&$ + #( % ),(%(",%- .) /01 &! # #%((#%,& #% 1234"%(#56*# %, (7(#"%,(%8#"% ("###) )&#% " $ )$&$ ! /8& 1/9 %1(&*$ )$&$ +$, ! $& )&- ! ! + .,- (&$ % %$ ! ! ! "$ ! (&$, /' # $ *3*(% #)( .,- (% #( % ),(%(",%- .) /01 &! ##%((#%, & #% 1234"%(#56*#%, (7(#"%,(%8#"% ("## #) )&#% :&& & & ,1#1 %,(),,4#4"%(#%, ()+%&#%-. " %&$'$ 0 &$ "$ 0-$$ /$ 1 !" $ 2$ $' )$&*$ "$ $ " & 1& .- 1 MEMORANDUM To:Mayor and City Council From:Mac Tristan, Chief of Police Date:November 13, 2018 Reference:Consider approval to purchase sixty-eight (68) Taser Black X2’s from Axon Enterprise in the amount of $127,731.00 as budgeted in FY 18/19, and authorizing the City Manager to sign any necessary documents. 2030:Sustainable City Government Introduction: Currently, every officer on Patrol Traffic, SRO and CID carry a Taser. Our existing Taser’s were purchased in 2013 and have reached the end of life cycle. By continuing to use the current Taser, the Police Department will have increased maintenance costs associated with the continued use of this Taser. The current Taser will have an increased risk of failure as the Taser ages which could result in officer injury or legal issues. Analysis: Every five years, the Taser reaches its end of useful life. This occurs because technology is changing and Axon, the manufacturer of the Taser, no longer supports or services this equipment. The older Taser will be out of warranty in December 2018, therefore any repair costs will have to be paid by the department. Legal Review: Agenda item does not require legal review. Fiscal Impact: Axon provided a bid for 68 Taser X2 units at a total cost of $127,731.00. These units will be purchased under the TX Smart Buy Contract No 680-A1. The funds are budgeted in the Police Departments general fund budget for FY 18-19. Recommendation: The Police Department recommends approval. ! ! " ! " #$% &'( #$% ) *#$ %$& $ $ %%+%$,-%+%$ ((++% ..! ' $ (&$ #% /' %+ 0 %1 +% %0 2!)#% 34 5%' ' '' 6 2' +7+' %0 "!80' +'6 $6 % ' %'+'6%+% '+%$% 0 ' ' '! 97 % : % '6 +5+%$'6; '+$% " $ )$&$ ! ;(01 +% %06+<+'2' +7+' %06+<+': % %, 7 06+<+'2++%$ '+% %7+$% %06+<+'#:$ 2 +'+%0 (&*$ )$&$ +$, ! $& )&- ! ! + .,- (&$ % %$ ! ! ! "$ ! (&$, /' # $ # ..! %%+%$,-%+%$ ((++% '6<+ = +%$ % # ..!+' %+ * .*.!+' %+ .,- +' %+ 0 %1 +% %0 2!)#% 34 5%' ' '' 6 2' + 7+' %0 "!80' +'6 $6 % ' %'+'6%+% '+%$% 0 ' ' '!97 % : % '6 +5+%$'6; '+$% 7(( !" " %&$'$ 1% 1'< ! '6 +' %+ % %+( 2!) #% 3 4 5% ' <>' ' '6 %+'+% ((% < '6 %%+%$ % -%+%$ ((++% %'6 + <%+'+%6 <%+% '+%''6 +% % 1% 7'(< ! '6 %%+%$ % -%+%$ ((++% % %+( ((% # 02!)#% 34 5%' +'6'60+%$%+'+%? 2%+'+%? #+%$0 $ +%$@0'60 %'0 A 0'6<++%$ < #+%$ 0 '6 0 +%$ 0 '6 +'+%$ (%(%' +$% 6+6 %' (' '6 %''< 8+ (%' #+%$0 +%+$% #+%$0 0 6++%+ '0 + +$6'+%$+0$ .+ +% # 0 : % % 6+6 + '6 0++% +% '6 +(' % +%$ % '6 ' % % '6 ' +% ' < (% ' %$ '6 ' ' +% )+'6'6 +%$ % '60'6<++%$'<' %0 +%$ * ;+0 '6<++%$ '+%'+% +%$0'6 % +'6+(+ ( ' + %6+$6'0'6: '%%'6<++%$ 7<(++%0 +'+% +0+ '+%%'6 '' 6 %(%(%'+$%+%' (0 ( ' + +$6'+%$ ' 6+ ' +%'< ''' +% (%' " #+'+% ((%' + < $% ' ' '6 '+( 0 2' + %$+% +%$ + % ++%$ (+' + 0 &$ /$ 1 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference:Consider approval of an ordinance for PD-285R-C, to attach a Detail Site Plan for a 1,168 sq. ft. drive-through and walk up restaurant, with no indoor seating. on 1.21 acres of property located at 180 W. Sandy Lake, and authorizing the Mayor to Sign. 2030: Business Prosperity Executive Summary: This Detail Site Plan approval is to allow the construction of a 1,168 sq. ft. Andy’s Frozen Custard with drive-through and walk up service, with no indoor seating. Introduction: The Detail Site Plan and Landscape Plan comply with requirements of the Zoning Ordinance in terms of use, coverage, setbacks, queuing for drive-though and the provision of landscaping. However, the prototype building design for this franchise does to not meet the exterior construction regulations or the sign standards as prescribed in the Zoning Ordinance. Staff worked with the landowner and Andy’s representatives over the past several months. This elevations and sign package represents a reasonable compromise allowing for the retention of the corporate branding while insuring compatibility with the abutting shopping center, and the community standards. The specific variances being recommended to the incorporated as PD conditions are listed below. Analysis: On October 9, 2018, the City Council unanimously approved PD-285R-C, Andy’s Frozen Custard subject to the conditions as recommended by the Planning and Zoning Commission, and the applicable conditions have been incorporated into the ordinance. On September 20, 2018, the Planning and Zoning Commission unanimously recommended Approval of PD-285R-C, Andy’s Frozen Custard, with the following conditions: 1. PD Conditions: a. Allowing for glass exceeding 50% of the front façade of the building. b. Allowing for the refacing of the existing monument sign which does not meet the current setback requirements. c. Allowing for a window sign. d. Allowing for a fully shielded indirect facia lighting, if grey/silver in color. 2 e. Approval of a Landscape Plan which provides allows the deficiency in the perimeter landscaping on the east and north property lines to be compensated along the west property line. 2. Revise the three parking spaces north of the building to be western facing. 3. Modify the building elevations to include a cladding of the canopy poles with similar material and height of the Leuders stone on the building. 4. Submission of additional specifications on the attached and monument signs in terms of materials, lighting source, etc. 5. This property will need to be replatted to provide necessary easements. 6. Additional comments will be generated at the time of Detail Engineering review and Building permit review. Legal Review: The City Attorney reviewed this ordinance Fiscal Impact: None Recommendation: The Planning Department recommends approval. Attachments: 1. Ordinance 2. Exhibit A – Legal Description 3. Exhibit B – Detail Site Plan 4. Exhibit C - Landscape Plan/Tree Survey 5. Exhibit D – Building Elevations and Signs City of Coppell Ordinance Pg 1 TM 103854 AN ORDINANCE OF THE CITY OF COPPELL, TEXAS ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF COPPELL, TEXAS, AMENDING THE COMPREHENSIVE ZONING ORDINANCE AND MAP OF THE CITY OF COPPELL, TEXAS, AS HERETOFORE AMENDED, BY GRANTING A CHANGE IN ZONING FROM C (COMMERCIAL) TO PD-285-C (PLANNED DEVELOPMENT-285 COMMERCIAL) TO ATTACH A DETAIL SITE PLAN FOR A 1,168 SQ. FT. DRIVE-THROUGH AND WALK UP RESTAURANT, WITH NO INDOOR SEATING, ON 1.21 ACRES OF PROPERTY LOCATED ON SANDY LAKE ROAD, WEST OF DENTON TAP (180 W. SANDY LAKE), AND BEING MORE PARTICULARLY DESCRIBED IN EXHIBIT “A” ATTACHED HERETO AND INCORPORATED HEREIN; PROVIDING FOR APPROVAL OF THE DETAIL SITE PLAN, LANDSCAPE PLAN/TREE SURVEY AND BUILDING ELEVATIONS/SIGNAGE, ATTACHED HERETO AS EXHIBITS “B” THOUGH “D”; AND PROVIDING FOR DEVELOPMENT REGULATIONS; PROVIDING A REPEALING CLAUSE; PROVIDING A SEVERABILITY CLAUSE; PROVIDING A SAVINGS CLAUSE; PROVIDING A PENALTY OF FINE NOT TO EXCEED THE SUM OF TWO THOUSAND DOLLARS ($2,000.00) FOR EACH OFFENSE; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City Planning and Zoning Commission and the governing body of the City of Coppell, Texas, in compliance with the laws of the State of Texas and pursuant to the Comprehensive Zoning Ordinance of the City of Coppell, have given requisite notices by publication and otherwise, and after holding due hearings and affording a full and fair hearing to all property owners generally, and to all persons interested and situated in the affected area and in the vicinity thereof, the said governing body is of the opinion that Zoning Application No. PD-285-C should be approved, and in the exercise of legislative discretion have concluded that the Comprehensive Zoning Ordinance and Map should be amended. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF COPPELL, TEXAS: SECTION 1. That the Comprehensive Zoning Ordinance and Map of the City of Coppell, Texas, duly passed by the governing body of the City of Coppell, Texas, as heretofore amended, be and the same is hereby amended by granting a change in zoning from C (Commercial) to PD-285-C, (Planned Development-285-Commercial) to attach a Detail Site Plan for a 1,168 sq. ft. drive-through and walk up restaurant, with no indoor seating, on 1.21 acres of property located on Sandy Lake Road, west of Denton Tap (180 W. Sandy Lake), for the property described in Exhibit “A” attached hereto and made a part hereof for all purposes. City of Coppell Ordinance Pg 2 TM 103854 SECTION 2. That the Property will be used and developed for Commercial and as a drive- through walk-up restaurant as provided in the Code of Ordinances, is hereby approved subject to the following development regulations: A. The building may have a front façade elevation, glass elements to exceed fifty percent (50%) of the front façade of the building. B. The existing monument sign may be retained and re-faced in accordance with the Code of Ordinances. C. A 42 square foot window sign shall be permitted as indicated on Building Elevation/Sign Plan in Exhibit “D”. D. Fully shielded, grey/silver indirect lighting shall be permitted on the perimeter facia as depicted on Building Elevation/Sign Plan Exhibit “D”. E. Compliance with Landscape Plan attached as Exhibit “C”. F. Property shall be replatted to provide necessary ingress/egress, fire lane and utility easements. SECTION 3. That the Detail Site Plan, Landscape Plan/Tree Survey, and Building Elevations/Sign Plan attached hereto as Exhibits “B” though “D”; respectively shall be deemed as development regulations to this development. SECTION 4. That the above property shall be used only in the manner and for the purpose provided for by the Comprehensive Zoning Ordinance of the City of Coppell, as heretofore amended, and as amended herein. SECTION 5. That the development of the property herein shall be in accordance with building regulations, zoning ordinances, and any applicable ordinances except as may be specifically altered or amended herein. City of Coppell Ordinance Pg 3 TM 103854 SECTION 6. That all provisions of the Ordinances of the City of Coppell, Texas, in conflict with the provisions of this ordinance be, and the same are hereby, repealed, and all other provisions not in conflict with the provisions of this ordinance shall remain in full force and effect. SECTION 7. That should any sentence, paragraph, subdivision, clause, phrase or section of this ordinance be adjudged or held to be unconstitutional, illegal or invalid, the same shall not affect the validity of this ordinance as a whole, or any part or provision thereof other than the part so decided to be unconstitutional, illegal or invalid, and shall not affect the validity of the Comprehensive Zoning Ordinance as a whole. SECTION 8. An offense committed before the effective date of this ordinance is governed by prior law and the provisions of the Comprehensive Zoning Ordinance, as amended, in effect when the offense was committed and the former law is continued in effect for this purpose. SECTION 9. That any person, firm or corporation violating any of the provisions or terms of this ordinance shall be subject to the same penalty as provided for in the Comprehensive Zoning Ordinance of the City of Coppell, as heretofore amended, and upon conviction shall be punished by a fine not to exceed the sum of Two Thousand Dollars ($2,000.00) for each offense; and each and every day such violation shall continue shall be deemed to constitute a separate offense. SECTION 10. That this ordinance shall take effect immediately from and after its passage and the publication of its caption, as the law and charter in such cases provide. DULY PASSED by the City Council of the City of Coppell, Texas, this the _______ day of ___________________, 2018. APPROVED: _____________________________________ KAREN SELBO HUNT City of Coppell Ordinance Pg 4 TM 103854 ATTEST: ___________________________________ CHRISTEL PETTINOS, CITY SECRETARY APPROVED AS TO FORM: ________________________________ CITY ATTORNEY JOB NO.DRAWN BY:DESIGNED BY:CHECKED BY:DATE:SHEET:REVISIONSDESCRIPTIONDATENO.B004167.001SEPTEMBER 26, 2018 PRELIMINARY SITE PLANC03.0LANLANCMBFILENAME: C05.0 SITE PLAN.dwgPLOTTED BY: Greg WescottPLOTTED ON: Wednesday, September 26, 2018FULL PATH: G:\Production4000\004100\4167\001\Civil\Drawings\Plot SheetsG:\Production4000\004100\4167\001\Civil\Drawings\Plot Sheets\C05.0 SITE PLAN M M M M M M711 M M&YIJCJU# JOB NO.DRAWN BY:DESIGNED BY:CHECKED BY:DATE:SHEET:REVISIONSDESCRIPTIONDATENO.B004167.001SEPTEMBER 26, 2018ANDY'S FROZEN CUSTARDCONNELL SKAGGS ADDITION1.215 ACRES, LOT 3R2, BLOCK 1COPPELL, TEXAS 75019LANDSCAPE PLANC03.0AGBJMMCMBFILENAME: C6.0 LANDSCAPE PLAN.dwgPLOTTED BY: Janel MoodyPLOTTED ON: Wednesday, September 26, 2018FULL PATH: G:\Production4000\004100\4167\001\Civil\Drawings\Plot SheetsG:\Production4000\004100\4167\001\Civil\Drawings\Plot Sheets\C6.0 LANDSCAPE PLANENGINEER:DUNAWAY ASSOCIATES L.P.550 BAILEY AVENUESTE. 400FORT WORTH, TEXAS 76107OWNER/DEVELOPER:ANDY'S FROZENCUSTARD211 E. WATER STREETSPRINGFIELD, MISSOURI65806ARCHITECT:URBAN BOBCAT ARCHITECTS916 BRYAN AVENUE, STE. 104FT WORTH, TEXAS 76104PRELIMINARYFOR REVIEW ONLYThese documents are forDesign Review and notintended forConstruction, Bidding orPermit Purposes. Theywere prepared by, orunder the supervision of:Adam G. BrewsterL.A.#22979/26/2018GRAPHIC SCALE IN FEET010 20 4020&YIJCJU$ &YIJCJU% 6 EXHIBIT A PROPERTY DESCRIPTION Being all of Lot 3R2 of the Connell Skaggs Addition, Replat, filed in Dallas County on 12/07/2017, Instrument Number 201700342476, containing 1.2149 acres, and known as 180 West Sandy Lake Road, Coppell, Texas 75019 ! " !"#$% !"& '#$ %$& $ $ ""("!)* "("! %%(( " ++ ' $ (&$ , -" .//(0 "( /" (""0/ 1& , -" .//(0' 1"$ "223 "("!04"!5$/ %1&6"" 1 %"$&(( " %%0(7$ $$041$(8($"/ ''5/ $,(("! "0 /"62 $'7 0$ "1"$ " & (%$/$ $4 /98"2 & :" $4 (3("!$4- $ (!" " $ )$&$ ! -% /.(""0/4(,($ 2! 10($( "/4(,($1$(8($"/ 4(,($2"0"/4(,($1 $( "/ (&*$ )$&$ +$, ! $& )&- ! ! + .,- (&$ % %$ ! ! ! "$ ! (&$, /' # $ ++""("!)* "("! %%(( " $4,(0 ;("!" ++($ "0( ' +'+($ "0( .,- ($ "( /" (""0/ 1& , -" .//(0'1"$ "22 3 "("!04"!5$/ %1&6""1 %"$&(( " %%0(7$ $$041$(8($"/ ''5/ $,(("! "0 / "62 $'7 0$ "1"$ "& (%$/$ $4 /98"2 !" & :"$4 (3("!$4- $ (!" 8%% " %&$'$ ." .0$ , $4 ($ "0( ""(% 1& ,<0$ $ $4 0 "($( " 0 %%" , $4 ""("! " * "("! %%(( " " $4 (0, 0 "($( "4,"("0 $("$ $4 (""0 ." 8$%, $4 ""("! " * "("! %%(( " ""(% 0 %%" /1& ($4$4/ ("!0 "($( "= 4%,($( "0 %%"$$$4$(% /(("!%($"1$( "!("("!&( &$ /2 $'%$, "/( ($41 "$( $ 0 "$0$( " ' (!"!%$%$ (""05(%"$ %04"(05(%"$$ ,0" &% /$4($("!00%"$$4$0"$"$4 !4 $( " /$4 ,(("! > 4 $ %$(040 % ($4($5(%"$/ ("$(<0"0 $4"000$( "$ ,, "$4 , /$4 $ $4($("! ("!$(" "!1"$ "& $ %("( $4($("!(%$"0$( "!1"$ "& $ %("( (, "0 ($4 / % > $ /$ "! $( " $ $4 / $4 $ ,%($$ 0($$//2$$ /#"$"$,$ "$4(0"$"$4 , -" ;. !("!$4%("$""0 /$40"("! $4$,$, $40 %% " $(" (/"4 ("!!%"$ ($4$4( $ 4""("!1$%"$0 %%" 0 &$ /$ 1 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference:Consider approval of an ordinance for PD-214R8-C to attach a Detail Site Plan for a 3,035-square foot building on 0.701 acres of land, located on Denton Tap Road, approximately 400 feet south of W. Sandy Lake Road and authorizing the Mayor to Sign. 2030: Business Prosperity Executive Summary: The request is to allow a 3,035-square foot building on this site. Variances were requested to support development on this irregularly shaped parcel of land. Introduction: This property sits between the McDonalds and the Schlotzsky’s/Cinnabon parcels on Denton Tap Road. A portion of the lot is developed, with existing parking along the Denton Tap Road Frontage. This infill lot has some challenges, as it is rather narrow, irregularly shaped, partially developed and approximately 45% of it is covered with existing access easements. There are 18 parking spaces proposed for the site, which would allow the building to be used for medical, retail or office. The site would need to be replatted to extend the fire lane easement to Denton Tap Road. The developable portion of this site is limited, contributing to the variances requested. Analysis: On October 9, 2018, the City Council unanimously approved PD-214R8-C, subject to the conditions as recommended by the Planning and Zoning Commission, and the applicable conditions have been incorporated into the ordinance. On September 20, 2018, the Planning and Zoning Commission unanimously recommended Approval of PD-214R8-C, with the following conditions: 1. There may be additional comments at the time of Building Permit and Detail Engineering Review. 2. Replat of Lot 3 must be approved and filed with Dallas County prior to construction. 3. All signage must meet ordinance requirements. 4. All mechanical equipment to be screened. 5. Removal of the existing access easement that currently runs through a portion of the building. 6. Photometrics shall comply with City requirements for residential adjacency. 7. To allow the landscape calculation to be based on the developable area of the lot. 8. To allow the existing parking tree islands along Denton Tap Road to remain as is. 2 9. To allow the existing perimeter landscape strip along Denton Tap Road to remain as is. 10. To allow a variable landscape width from 6 to 10 feet along a portion at the rear of the property. 11. To submit to city staff a Letter of Intent between the applicant and the Arbor Manors HOA regarding the maintenance of the screening wall that abuts both common property lines. 12. To verify any shared parking agreements with this property. Legal Review: The City Attorney reviewed this ordinance Fiscal Impact: None Recommendation: The Planning Department recommends approval. Attachments: 1. Ordinance 2. Exhibit A – Legal Description 3. Exhibit B – Detail Site Plan 4. Exhibit C - Landscape Plan 5. Exhibit D – Elevations City of Coppell Ordinance Pg 1 TM104004 AN ORDINANCE OF THE CITY OF COPPELL, TEXAS ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF COPPELL, TEXAS, AMENDING THE COMPREHENSIVE ZONING ORDINANCE AND MAP OF THE CITY OF COPPELL, TEXAS, AS HERETOFORE AMENDED, BY GRANTING A CHANGE IN ZONING FROM PD-214R2-C (PLANNED DEVELOPMENT 214-REVISION 2-COMMERCIAL) TO PD-214R8-C (PLANNED DEVELOPMENT-214 REVISION 8-COMMERCIAL) TO ATTACH A DETAIL SITE PLAN FOR A 3,035-SQUARE FOOT BUILDING ON 0.701 ACRES OF LAND, FURTHER IDENTIFIED AS 131 S. DENTON TAP, AND BEING MORE PARTICULARLY DESCRIBED IN EXHIBIT “A” ATTACHED HERETO AND INCORPORATED HEREIN; PROVIDING FOR APPROVAL OF THE DETAIL SITE PLAN, LANDSCAPE PLAN AND ELEVATIONS; ATTACHED HERETO AS EXHIBITS “B” THOUGH “D”; AND PROVIDING FOR DEVELOPMENT REGULATIONS; PROVIDING A REPEALING CLAUSE; PROVIDING A SEVERABILITY CLAUSE; PROVIDING A SAVINGS CLAUSE; PROVIDING A PENALTY OF FINE NOT TO EXCEED THE SUM OF TWO THOUSAND DOLLARS ($2,000.00) FOR EACH OFFENSE; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City Planning and Zoning Commission and the governing body of the City of Coppell, Texas, in compliance with the laws of the State of Texas and pursuant to the Comprehensive Zoning Ordinance of the City of Coppell, have given requisite notices by publication and otherwise, and after holding due hearings and affording a full and fair hearing to all property owners generally, and to all persons interested and situated in the affected area and in the vicinity thereof, the said governing body is of the opinion that Zoning Application No. PD-214R8-C should be approved, and in the exercise of legislative discretion have concluded that the Comprehensive Zoning Ordinance and Map should be amended. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF COPPELL, TEXAS: SECTION 1. That the Comprehensive Zoning Ordinance and Map of the City of Coppell, Texas, duly passed by the governing body of the City of Coppell, Texas, as heretofore amended, be and the same is hereby amended by granting a change in zoning from PD-214R2-C (Planned Development 214-Revision 2-Commercial) to PD-214R8-C (Planned Development 214-Revision 8-Commercial) to attach a Detail Site Plan for a 3,035-square foot building on 0.701 acres of land, located on Denton Tap Road, approximately 400 feet south of W. Sandy Lake Road. for the property described in Exhibit “A” attached hereto and made a part hereof for all purposes. City of Coppell Ordinance Pg 2 TM104004 SECTION 2. That the Property will be used and developed for Commercial purposes as provided in the Code of Ordinances, is hereby approved subject to the following development regulations: A. Except as amended herein and as provided in this Ordinance, the property shall be developed and use in accordance with “C” Commercial District Regulations as set forth in Ordinance 91500-A-474 which is incorporated herein as set forth in full and hereby republished B. Photometric (Lighting) of the site shall comply with City requirements for residential adjacency. C. Landscaping shall be in conformity with the Landscape Plan as provided in Exhibit C and comply with the following: 1. Allow the landscape calculation to be based on the developable area of the lot; 2. Allow the existing parking tree islands along Denton Tap Road to remain as currently configured and maintained. 3. Allow the existing perimeter landscape strip along Denton Tap Road to remain as currently configured and maintained. 4. Allow a variable landscape width from 6 to 10 feet along a portion at the rear of the property as depicted on Landscape Plan. D. To allow a 10-foot setback in lieu of the required 30-foot setback on the southern portion of the lot as reflected in this Site Plan. E. All signage must meet ordinance requirements in accordance with Article 29 of the Code of Ordinances Chapter 12 - Zoning. F. All mechanical equipment to be screened in accordance with Article 33 of the Code of Ordinances Chapter 12 - Zoning. City of Coppell Ordinance Pg 3 TM104004 G. Replat of Lot 3 to add easements and to remove the existing access easement that currently runs through a portion of the proposed building; such replat must be approved and filed with Dallas County prior to the issuance of a building permit. SECTION 3. That the Detail Site Plan, Landscape Plan, and Elevations attached hereto as Exhibits “B” though “D”; respectively shall be deemed as development regulations to this development. SECTION 4. That the above property shall be used only in the manner and for the purpose provided for by the Comprehensive Zoning Ordinance of the City of Coppell, as heretofore amended, and as amended herein. SECTION 5. That the development of the property herein shall be in accordance with building regulations, zoning ordinances, and any applicable ordinances except as may be specifically altered or amended herein. SECTION 6. That all provisions of the Ordinances of the City of Coppell, Texas, in conflict with the provisions of this ordinance be, and the same are hereby, repealed, and all other provisions not in conflict with the provisions of this ordinance shall remain in full force and effect. SECTION 7. That should any sentence, paragraph, subdivision, clause, phrase or section of this ordinance be adjudged or held to be unconstitutional, illegal or invalid, the same shall not affect the validity of this ordinance as a whole, or any part or provision thereof other than the part so decided to be unconstitutional, illegal or invalid, and shall not affect the validity of the Comprehensive Zoning Ordinance as a whole. SECTION 8. An offense committed before the effective date of this ordinance is governed by prior law and the provisions of the Comprehensive Zoning Ordinance, as amended, in effect when the offense was committed and the former law is continued in effect for this purpose. SECTION 9. That any person, firm or corporation violating any of the provisions or terms of this ordinance shall be subject to the same penalty as provided for in the Comprehensive Zoning Ordinance of the City of Coppell, as heretofore amended, and upon conviction shall be punished by a City of Coppell Ordinance Pg 4 TM104004 fine not to exceed the sum of Two Thousand Dollars ($2,000.00) for each offense; and each and every day such violation shall continue shall be deemed to constitute a separate offense. SECTION 10. That this ordinance shall take effect immediately from and after its passage and the publication of its caption, as the law and charter in such cases provide. DULY PASSED by the City Council of the City of Coppell, Texas, this the _______ day of ___________________, 2018. APPROVED: _____________________________________ KAREN SELBO HUNT ATTEST: ___________________________________ CHRISTEL PETTINOS, CITY SECRETARY APPROVED AS TO FORM: ________________________________ CITY ATTORNEY Legal Description Being all of Lot 3, Block A of the Arbor Manors Addition, being a portion of Minor Amending Plat of Lots 1-4, Block A and Lot 1 Block B, of the Arbor Manor Addition, filed with Dallas County on September 9, 2008, Instrument Number 20020292484, containing 0.701 acres of land, address known as 131 S. Denton Tap Road, Coppell, Texas 75019 Exhibit “A” EXHIBIT "B" - DETAIL SITE PLAN X;#Hĭĭ,+2ĭ1+H`ĭ#8,,b2O#ĭ2%ĭ fg>V U %T bXZQm<Ym!!m;=ĭĭ qèqèqèqèqè$ĝĭĭ èèĭqèqèqèqèR>èqèqèrq[èqè ;=9MĭX1#Hĭĭ,+2ĭ1+H`ĭ#8,,b2Of1ĭ:&Mĭ3Oĭ9ÊĭQ68#=m st uèvèqèqèqèqèqèqèqè£t Bĭ ĭAĭĭĭ ĭĭĭPBĭ ĭ ĭ-ĭ ĭĭê Üĭn Bĭĭ Iĭĭf ĭ ĭĭ ĭ eĭ ĭĭeĭo ĭĭĭ ĭĭĭĭĭĭĭ- ĭĭ ĭĭĭ¯ĭ-ĭ ĭ <ĭĭ-ĭĭĭ <ĭÇ ĭĭĭĭĭ ĭĭĭĭĭTUĭëĭĭ-ĭAĭ1nĭ < ĭĭ ĭĭ ĭĭĭĭ <Ë ĭ ĭĭ <ĭĭ ĭĭT\UĭYĭĭ ĭÞ ĭ FĭĭI ĭ e ĭĭĭĭĭTo\Uĭ ĭĭĭĭ Fĭ ĭ ĭ ĭĭBĭr ĭĭ- Aĭĭ Aĭĭ ĭĭĭ ĭAĭĭĭTr\UĭY?ĭÌ ĭĭIPìĭĭĭ- ĭ ĭĭPĭ ĭAĭuĭĭĭTr\UĭYĭÍ ĭ cĭĭI ĭ- ĭĭĭÖ ĭĭĭÔBĭĭĭI 9 ĭ cĭ ĭ ĭĭĭĭĭ ĭĭ-ĭFĭĭĭ <ĭ-Pĭ <ĭ ĭĭ<ĭY ĭĭFĭĭFĭ ĭĭĭ 9c ĭĭ ĭĭA uĭĭĭBFĭIPeĭĭ-noĭĭuĭ ĭ ĭĭ ĭĭçĭ ĭ< ¿ĭĭ B ĭĭYĭĭ- Aĭĭ ĭ d*/ĭÛ*ĭ($ ĭk G^j7^q'Nĭ ("0 ĭZ ĭ.D ĭÒ ĭt "0$ .ĭ@Sĭ''WNĭ ("0 ĭa ĭ )#4$4 ("/4@@?'qSĭæ^^?È'ĭ("05 ĭa ĭ Åĭd5ĭÿĭ [gĭ'ĭC ĭ*CĭC*J ĭa*J ĭ JgĭW_?''ĭZ ĭ%" ,4 %*4.%44%*4%" +4 &*4%"044 %*4¼öēĔđČ½¬čĭ_j GN7ĭ("]ĭZ]ĭJ%RRĭ% ę hzĭ ĭ0$/$ .ĭ Cĭ*CþkR ĭDă$Jĭ.ĭ/*.$Jĭ GSĭ*5ĭ_G@ĭ("ĭØĭh$$h0hĭ{ "0${ .ĭCĭ/.D$JĭGĭd Áĭ [gĭq("ĭ×ĭ*Cĭ "ĭ$ Ć)*5ĭĄ.R[z ĭ +$"'4 !)#4'"/4 ß*kE g$[0/ĭàz ĭ(D[ ĭá{*E$. .ĭW''ĭ("05 ĭa ĭ @Sĭ*Cĭ() ĭt "0)5 .ĭ''W?Nĭ ("?ĭZ?ĭGĭè ĭD ĭ@ĭ("]ĭZ?ĭt "0$ .ĭÑĭNĭ RN @Sĭ@j7 _Wĭ("]ĭ+m,B)3<)1-m-C;Dm,?+m<Ym$#m qèt 9 ĭ Fĭĭĭ cĭĭĭĭĭ ĭBĭ äIPĭ ĭĭĭåĭ G'ĭd Rĭ m,B)3<)1-m-C;Dm,?+m<Ym$#m qèqèqèqèvètèwªèw;=&ĭX;#Hĭ+ĭ+8X8ĭQ+28,ĭ#ĭ2%ĭÏ&p:7Q8#ĭ;=9ĭ qèÕè ¹è =&m $ .7>H2>.>02R $ qè%62R@L>2CRH2>.>HR.>1RH627DR.52>HR73R.>MRG6.;<R/2R9@7>H;MR.>1RG2K2D.;<MRE2GA@>G7/;2R4DRI62R=.8>H2>.>02R@3R.;;R;.>1G0.A8>5 R;;RD2BJ7D21R;.>1G0.A7>5RG6.;;R/2R=.7>H.7>21R '-8)8 - - '&8')8-8+ -8+8&8()1 '/+$28()'1 8)8 8&+(!&8+%$88 )) -8 $ *+è $õ¾ĭ0ûĭ$ Ğĭ ¨è9ø«ĭÆĭ ;=MX1#H+Q63mĭQ42+1¡,ĭ+b=b2f1ĭ7V&99Mĭ3Oĭ&:&ÉĭQ686#6 qèqèqèqèqè ÷ĭwè¤èvè Öqq×è NØ>èÙÚè>aèwÛè00ĀěĭğĠ Ùġ43414 2qwÜèqèÉ«èÝèĎĊĭ Þßèqè7>R.R>2.HR.>1R@D12D;MR=.>>2DR.HR.;;RH7=2GR%67GRG6.;;R8>0;J12R=@L7>5R2157>5RADJ>7>5R32DH7;7N7>5RL.H2D7>5RL2217>5R.>1R@H62DRGJ06R.0H7K7H82GR0@==@>RH@RH62R=.7>H2>.>02R@3R;.>1G0.A7>5 R.>1G0.A21R.E2.GRG6.;;R/2R:2AHR3D22R@3RHD.G6R;7HH2FRL221GR.>1R@I62DRGJ06R=.H2D7.;R@DRA;.>HGR>@HR.RA.DHR@3RH62R;.>1G0.A7>5 R;;RA;.>HR=.H2D7.;GRG6.;;R/2R=.7>H.7>21R7>R.R62.;H6MR.>1R5D@L8>5R0@>17H7@>R.GR7GR.AAD@AD8.H2R4DRH62RG2.G@>R@3RH62RM2.DR!;.>IR=.H2F7.;GRL6706R172RG6.;;R/2RE2A;.021RL7H6RA;.>HR=.I2D7.;R@3RG7=7;.DRK.D72HMR.>1RG7O2 R + + FPOLèÑÒÓÔÓÒÓÒÓÒÓÔÓÒÓÒÓÒÓÔÓÒÓÒÓÒÓÔÓÒÓÒÓÒÓÒèd·±Áèm·»»??OPè´¦² è|³Âèn·¼¼è¶1èj½1è³¥è³èh¢èÁ¡è³·èoÅ·³»è¯è è"$°èqèSè_èqèàèďĢÂĭºģ£úćĈĭ¢Ĝĭ qèá\aè *0,8@D?è*,8 Äè·¦Â½èLèm³²è}¥²¥±Á±èF<è¥²è¢½è½è´²½¥²¡è&2 +2 2 !,$(2 -2)*20'2 è8è CKè âµèèÊË,èqè-è°»¸±qèãZèÍè " Î]èè 7è.è ! "#$ " x ¬è?-R"$R `èè/èÈèqè eQ3DL/QZAA-86'_W:-\;D`Z:]m :èE.hZa-Bic2E QZ`Z9RROA[^PPm4m Sjk#34.5"#678A)B7I)KmGE393DlC)<,m,B)3)1(-C;DmMNNm !"#$%&'()*+,-./ ĥĭ è#$#! yèäè #$ " ²ĭ s%/~MDyxî0D%7Ă6$Vĭ!KMĭ,%Ė|ā5ĭ1)E9ĭ)Ĥ¨4!ĭċ)ĭ7:ĭD)xĭ1%EO!>ÄÐĭñòĭ ĕĐmĭ}Àĭª³óĭ å8Ï+%&'æè00 00000000èÌ(çÐ)^èz 44441 2 2"#22/2222222%2 $è 0è0è®4%5!})E,)üĘ!/Kĭ::ĭ ,66ĭ§Ě+4©ĭ RQRzèĦĭħĨĭĩĭ¤¥ĭĪĭ ð è =è-4Àè2 .&pĭ 3%>|ĭ!Kĭ9ĭyĭ4!/ĭĭ35>LEą¦&9ĭ 3%>|ĭ!Kĭ:ĭ )ĭ4!/ĭĭ3Lw>;=VĭiVĭ s!4KL5~ĭ:ĭ )ĭ4!/ĭl 3Ē>ôýĭvĭvĭvÃīĭ´ĉHÕÓ2ĭfÚ1ÝO`ĭ,ãí+8`ĭ;éĭùĭi7ĭ 3%>}ĭ!Kĭ&Vĭ )4!/ĭl 3L>LEwĭd*@AB?Jm+-<F-B:5<-m?0D-J)CmA?I-Bmm:512Em+?m-C;EH?9m""mA1m!m#ĭ2%ĭ&p&:9&76â8#=6ĭï%)xÎĭ#ĭ¶·Ĭµ¹ėi&ĭ s!4K5L~ĭ7ĭ yĭ4!/ĭl 3Lw>E!<èA<èE<èH<è<mPR?DèhÄ¥»½¥²¡è··»ºèEèi±èf·èGè¦²2èè±§²èFè¥²1èè±¥²èMè©è³Á¾¢·²è|¦ÂèFè¥²1èè±¥²èp³Æè´¦² èÁ´³²èOè3è*?<è¿4èkÁè½³èm·³Á²è¦¾èg¾TèiÄ¦¼¾¦² è³²§² Uèfè·³´³¼è¼Vè¦;~¦è¶Á·èl³³¾ WèG<GIè¼¦² è¾²²¾èeÁ¦§² èp¦ ¢¾UèEEè|³¾è¼¦ÇXèG<IBQèf³Â· Q2Oèl³³·è·è·¾¦³èBèVI5JJè·©¦² Vè·©¦² è·¶Á¦·èG<GIè¼;èG<<èBAè¼´¼èE<<èBJè¼´¼è ¾¦è;èBMIèBOè¼´¼è ~¦è·©¦² è´·³Â¦BOè¼´¼è§è $"9$ 9$%&!99"3+45109#1(*9$6,5+9 9(.(49%'99*(8,*,"-(0(7*4)(2+4)1/Ã²·Vèc´´®¦²¾Yè~³·²èf´¦¾³è||fèf¾¼*f·©èèc¼¼³¦¾¼è||èBHO<<èÁ·Á±èg·¦ÂèÁ¦¾èE<<èg¼èÄ¼èMIEIHèOEBHè¼¾¢¼¾·èg·è¾èII<èg¼èÄèMIEEIèc¾¾²Wèf±·³²è|{Á²èEBH*IE<*Q<<<èb±³·²´2³± c¾¾²Tèg²¦è¾Ã¸¾èQME*GOI*EEMEè¼¾Ã¸¾b¾¼*·©6³± % R%!R #R %RR RR# #R #$RRR! #R$RR)#RR# )R$'#(+R%+R R !!R$R '&,R%*$R +&!#+"(+'%++$+)$+ + ++ + $ $ +EXHIBIT "C" - LANDSCAPE PLAN EXHBITI "D" - ELEVATIONS EXHBITI "D" - ELEVATIONS ! !"#$% !"& '"# $#% # # ""("!)* "("! %%(( " ++ & # '%# ,($&(! ($( "-.$/0 "( 1"2(""/1 3&'4,($&(! ($( " 5 $'& / 3-6707 "("!/6"!8$1 %3&4 -""3 %"$&(( "4(!6 %%/(0$ 3&'4-""3 %"$&(( "'4(!6 %%/(0$ %"$6""3 %"$$ $$/63$(9($" $ :81 $%(/;(("! "'/ 1 $ /$" $6 1$6" $6 $/ " 194"7<" $6 (7("!$6= $ (!" ! # (#%# =% 12(""/16(;($ 5! 3/($( "16(;($3$(9($"1 6(;($5"/""91 6(;($3$( "16(;($9(!"!1 6(;($>&"("!1 '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # ++""("!)* "("! %%(( " $6;(/ 4("!" ++($ "/( ' +'+($ "/( -+, ($ "( 1"2(""/1 3&'4,($&(! ($( "5 $'& / 3 ! -6707 "("!/6"!8$1 %3&4-""3 %"$ &(( "4(!6 %%/(0$ 3&'4-""3 %"$&(( " '4(!6 %%/(0$ %"$6""3 %"$$ $$/63$(9($"$ :81 $%(/;(("! "'/ 1 $ /$" $6 1$6 " $6 $/ " 194"7<"$6 (7("!$6= $ (!" 9%% ! $%#&# 2" 2/$ ; $6 ($ "/( ""(% 3&'4 .$/ ;?/$ $ $6 / "($( " / %%" ; $6 ""("! " * "("! %%(( " " $6 (/;/ "($( "6;"("/ $("$ $6 (""/ 2" 9$%; $6 ""("! " * "("! %%(( " ""(% / %%" 13&'4.$/ ($6$61 ("!/ "($( "@ 6%;($( "/ %%"$$$6$(% 1(("!%($"3$( "!("("!&( &$ 15 $'"%$; "1( ($63 "$( $ / "$/$( " ' (!"!%$%$ (""/8(%"$ 6""("!3$%"$/ %%" / %# .# 0 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference:Consider approval of an ordinance for PD-205R3-HC, to amend the Planned Development to attach a Detail Site Plan to allow a 6,520-square-foot medical building on 1.39 acres of property located north of the northwest corner of S.H. 121 and Plaza Boulevard and authorizing the Mayor to Sign. 2030: Business Prosperity Executive Summary: This Detail Site Plan approval is to allow the construction of a 6,520-square foot medical building on 1.39 acres of property. Introduction: The requested Planned Development amendment is to allow a 6,520-square-foot medical building on 1.39 acres which will require the replatting of Lots 3 and 4 into one lot. The architectural character of this building is similar to the buildings to the south and west of it and access to this site is provided via a proposed driveway approach on Plaza Blvd as well as an existing access and fire lane easement that runs north-south from Lot 1 through Lot 6. Parking provided exceeds the minimum requirement and the building will be fully sprinklered. The PD conditions are listed below. Analysis: On October 9, 2018, the City Council unanimously approved PD-205R3-HC, Questcare subject to the conditions as recommended by the Planning and Zoning Commission, and the applicable conditions have been incorporated into the ordinance. On September 20, 2018, the Planning and Zoning Commission unanimously recommended Approval of PD-205R3-HC, Questcare, with the following conditions: 1. There may be additional comments at the time of Building Permit and Detail Engineering Review. 2. Replat of Lots 3 and 4 must be approved and filed with Dallas County prior to construction 3. All signage must meet ordinance requirements Legal Review: The City Attorney reviewed this ordinance 2 Fiscal Impact: None Recommendation: The Planning Department recommends approval. Attachments: 1. Ordinance 2. Exhibit A – Legal Description 3. Exhibit B – Detail Site Plan 4. Exhibit C - Landscape Plan/Tree Survey 5. Exhibit D – Elevations 6. Exhibit E – Signage 7. Exhibit F - Renderings City of Coppell Ordinance Pg 1 TM 103855 AN ORDINANCE OF THE CITY OF COPPELL, TEXAS ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF COPPELL, TEXAS, AMENDING THE COMPREHENSIVE ZONING ORDINANCE AND MAP OF THE CITY OF COPPELL, TEXAS, AS HERETOFORE AMENDED, BY GRANTING A CHANGE IN ZONING FROM PD-205R-HC (PLANNED DEVELOPMENT 205-REVISED- HIGHWAY COMMERCIAL) TO PD-205R3-HC (PLANNED DEVELOPMENT- 205 REVISION 3-HIGHWAY COMMERCIAL) TO AMEND THE PLANNED DEVELOPMENT TO ATTACH A DETAIL SITE PLAN TO ALLOW A 6,520- SQUARE-FOOT MEDICAL BUILDING ON 1.39 ACRES OF PROPERTY LOCATED NORTH OF THE NORTHWEST CORNER OF S.H. 121 AND PLAZA BLVD, AND BEING MORE PARTICULARLY DESCRIBED IN EXHIBIT “A” ATTACHED HERETO AND INCORPORATED HEREIN; PROVIDING FOR APPROVAL OF THE DETAIL SITE PLAN, LANDSCAPE PLAN/TREE SURVEY, ELEVATIONS, SIGNAGE AND RENDERINGS; ATTACHED HERETO AS EXHIBITS “B” THOUGH “F”; AND PROVIDING FOR DEVELOPMENT REGULATIONS; PROVIDING A REPEALING CLAUSE; PROVIDING A SEVERABILITY CLAUSE; PROVIDING A SAVINGS CLAUSE; PROVIDING A PENALTY OF FINE NOT TO EXCEED THE SUM OF TWO THOUSAND DOLLARS ($2,000.00) FOR EACH OFFENSE; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City Planning and Zoning Commission and the governing body of the City of Coppell, Texas, in compliance with the laws of the State of Texas and pursuant to the Comprehensive Zoning Ordinance of the City of Coppell, have given requisite notices by publication and otherwise, and after holding due hearings and affording a full and fair hearing to all property owners generally, and to all persons interested and situated in the affected area and in the vicinity thereof, the said governing body is of the opinion that Zoning Application No. PD-205R3-HC should be approved, and in the exercise of legislative discretion have concluded that the Comprehensive Zoning Ordinance and Map should be amended. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF COPPELL, TEXAS: SECTION 1. That the Comprehensive Zoning Ordinance and Map of the City of Coppell, Texas, duly passed by the governing body of the City of Coppell, Texas, as heretofore amended, be and the same is hereby amended by granting a change in zoning from PD-205R-HC (Planned Development 205-Revised- Highway Commercial) to PD-205R3-HC (Planned Development-205 Revision 3- Highway Commercial) to attach a Detail Site Plan for a 6,520 sq. ft. medical building on 1.39 acres of property located north of the northwest corner of S.H. 121 and Plaza Blvd, for the property described in Exhibit “A” attached hereto and made a part hereof for all purposes. City of Coppell Ordinance Pg 2 TM 103855 SECTION 2. That the Property will be used and developed for a medical office building and other Commercial purposes as provided in the PD-205R3-HC and Code of Ordinances, is hereby approved subject to the following development regulations: A. Except as amended herein and as provided in this Ordinance, the property shall be developed in accordance with PD 205R-3-HC Highway Commercial zoned property as set forth in Ordinance 91500-A-415, and, the adopted ordinance which is incorporated herein as if set forth in full and hereby republished B. Replat of Lots 3 and 4 to conform with the Detail Site, as depicted in Exhibit B, must be approved and filed with Dallas County prior issuance of building permits. C. Compliance with the Landscape Plan and Tree Survey as set forth in Exhibit C. D. All signage shall comply with the Sign Plan and Code of Ordinances, except as provided in Exhibit E. E. Photometric (Lighting) of the site shall comply with City requirements for residential adjacency. F. Building Elevations shall be constructed in compliance with Elevation Plan and the notes contain therefore as provided in Exhibit D and substantial compliance with Renderings in Exhibit F. SECTION 3. That the Detail Site Plan, Landscape Plan/Tree Survey, Elevations, Signage and Renderings attached hereto as Exhibits “B” though “F”; respectively shall be deemed as development regulations to this development. SECTION 4. That the above property shall be used only in the manner and for the purpose provided for by the Comprehensive Zoning Ordinance of the City of Coppell, as heretofore amended, and as amended herein. City of Coppell Ordinance Pg 3 TM 103855 SECTION 5. That the development of the property herein shall be in accordance with building regulations, zoning ordinances, and any applicable ordinances except as may be specifically altered or amended herein. SECTION 6. That all provisions of the Ordinances of the City of Coppell, Texas, in conflict with the provisions of this ordinance be, and the same are hereby, repealed, and all other provisions not in conflict with the provisions of this ordinance shall remain in full force and effect. SECTION 7. That should any sentence, paragraph, subdivision, clause, phrase or section of this ordinance be adjudged or held to be unconstitutional, illegal or invalid, the same shall not affect the validity of this ordinance as a whole, or any part or provision thereof other than the part so decided to be unconstitutional, illegal or invalid, and shall not affect the validity of the Comprehensive Zoning Ordinance as a whole. SECTION 8. An offense committed before the effective date of this ordinance is governed by prior law and the provisions of the Comprehensive Zoning Ordinance, as amended, in effect when the offense was committed and the former law is continued in effect for this purpose. SECTION 9. That any person, firm or corporation violating any of the provisions or terms of this ordinance shall be subject to the same penalty as provided for in the Comprehensive Zoning Ordinance of the City of Coppell, as heretofore amended, and upon conviction shall be punished by a fine not to exceed the sum of Two Thousand Dollars ($2,000.00) for each offense; and each and every day such violation shall continue shall be deemed to constitute a separate offense. SECTION 10. That this ordinance shall take effect immediately from and after its passage and the publication of its caption, as the law and charter in such cases provide. City of Coppell Ordinance Pg 4 TM 103855 DULY PASSED by the City Council of the City of Coppell, Texas, this the _______ day of ___________________, 2018. APPROVED: _____________________________________ KAREN SELBO HUNT ATTEST: ___________________________________ CHRISTEL PETTINOS, CITY SECRETARY APPROVED AS TO FORM: ________________________________ CITY ATTORNEY 6 EXHIBIT A Description >Kdϲ͕>K<DE/E'W>dK&s/^dZ/'Zd/>ηϮϬϬϴϬϮϴϮϴϵϱDZd>KdϮ͕>K<͕s/^dZ/';d,W>ͿsK>͘ϮϬϬϱϬϵϰ͕W'ϳϲDZd>Kdϱ͕>K<s/^dZ/';d,W>ͿsK>͘ϮϬϬϱϬϵϰ͕W'ϳϲDZd1:6(48(67&$5(&/,1,&9,67$5,'*(7+(3/$=$$'',7,21/275%/2&.'$&5(6=21('3'5+&*,/%(57&:22/6(<6859(<$%675$&712&,7<2)&233(//'$//$6&2817<7(;$62:1(5+,-2/7':$55(13.:<%/'*68,7()5,6&27; &217$&7*(25*(0,7&+(//*0,7&+(//#'$//$6&2:%2<61(7$33/,&$1772'',17(5(6761257+(59$<6768,7('$//$67; &217$&7&+$5/,(6+(/%<&6+(/%<#72'',17(5(676&20(1*,1((5 /$1'6&$3($5&+,7(&7%$,5'+$03721 %52:1,1&:,//,$0'7$7($9(68,7(*5$3(9,1(7; (1*,1((5(/$,1(3,&.(5,1*3((3,&.(5,1*#%+%,1&&20/$1'6&$3($5&+,7(&7720.(//2**5/$7.(//2**#%+%,1&&20VICINITY MAPCITY OF COPPELL, TX1"=1000'SITE'(7$,/6,7(3/$1EXHIBIT "B" - DETAIL SITE PLAN NWSESe 17, 2018QUESTCARE CLINICVISTA RIDGE (THE PLAZA) ADDITIONLOT 3R, BLOCK D1.39 ACRES, ZONED PD-205R3-HCGILBERT C. WOOLSEY SURVEYABSTRACT NO. 1792CITY OF COPPELL, DALLAS COUNTY, TEXASOWNER:HIJO LTD8000 WARREN PKWY BLDG 1, SUITE 100FRISCO, TX 75034(972) 867-1886CONTACT: GEORGE MITCHELLGMITCHELL@DALLASCOWBOYS.NETAPPLICANT:TODD INTERESTS400 NORTH ERVAY ST, SUITE 150DALLAS, TX 75205(214) 468-0707CONTACT: CHARLIE SHELBYCSHELBY@TODDINTERESTS.COMENGINEER & LANDSCAPE ARCHITECTBAIRD, HAMPTON, & BROWN, INC.3801 WILLIAM D TATE AVE, SUITE 500GRAPEVINE, TX 76051(817) 251-8550ENGINEER: ELAINE PICKERING, P.E.EPICKERING@BHBINC.COMLANDSCAPE ARCHITECT: TOM KELLOGG, RLATKELLOGG@BHBINC.COMVICINITY MAPCITY OF COPPELL, TX1"=1000'SITELANDSCAPE PLAN/TREE SURVEYEXHIBIT "C"-LANDSCAPE PLAN/TREE SURVEY 72&522) $%5,&.9(1((5%$/80,180&23,1*37+58:$//6&833(5&21'8&725%2;$1''2:1632873$,17720$7&+$'-$&(17),1,6+($67(/(9$7,216)0$6215<6)(,)66)0,6&0(7$/ 6)(,)6(%5,&.9(1((5% 7+58:$//6&833(5&21'8&725%2;$1''2:1632873$,17720$7&+$'-$&(17),1,6+ &$676721(6772&522) $%5,&.9(1((5%522)/$''(5:,7++,1*('/2&.$%/( +,*+6(&85,7<&29(5:,7+3$'/2&.$1'&/$633$/80,180&23,1*3($67(/(9$7,216)0$6215< 6) 0,6&0(7$/ 6) 6,*1$*($5($6,*1$*(81'(56(3$5$7(&2175$&7&$676721($&&(17:$//67$%&'()72&522) $%5,&.9(1((5%3$,17('+2//2:0(7$/'225 )5$0(3&$676721(67$(66/(9(/6758&785$/67((/&$123<3$,17('3(,)6($/80,180&23,1*&$33$/80,180&23,1*&$336287+(/(9$7,216)0$6215<6)0,6&07/6)$8720$7,&6:,1*'225$/80,1806725()52176<67(0&$676721(67 7(03(5('*/$66,168/$7('*/$=,1*81,7%5,&.9(1((5%&$17,/(9(5('6721(:$//676,*1$*($5($6,*1$*(81'(56(3$5$7(&2175$&7&225',1$7($1'3529,'(%/2&.,1*3(56,*1$*(3$&.$*(%5,&.9(1((5%%5,&.9(1((5%72&522) $$/80,1806725()52176<67(0$5&+,7(&785$/(;326('6758&785$/67((/&$123<3%5,&.9(1((5%:22'6/$762)),7:'a6)$/80,180&23,1*3$/80,180&23,1*3&$676721($&&(17:$//671257+(/(9$7,216)0$6215<6)(,)66)0,6&07/ 6)+2//2:0(7$/'225$1')5$0((,)6($$$%()'&$676721(67&2'('(6&5,37,21&2/25),1,6+67</(6,=(0$18)$&785(5%((03336767:'%5,&.9(1((5.,1*9(/2857(;785(%$5%(55<&217$&7127(6(,)6(,)60(7$/3$1(/3$,173$,176721(9(1((56721(9(1((5:22'6/$76$&0(%5,&.*528763(&7580&(0(176%5$=26%52:12$.%522.352/('*(&2521$'26721(352'8&766$1'3(%%/(),1(683(5:+,7('5<9,728768/$7,216<67(06$1'3(%%/(),1('5<9,728768/$7,216<67(00,'6800(51,*+7&('$51$785$/6($/(';120,1$/3529,'(63$&,1*%(7:((16/$763$,1768%675$7(%/$&.%(<21'5('2$.5(),1(':22'6721(720$7&+3%(1-$0,10225(72%(86('21'2:1632876$'-$&(1772%0$7&+(%%5,&.9(1((59(/2857(;785(.,1*$&0(%5,&.81,9(56,7<%52:10$7&+3$,17333$,172&%$%<)$:1%(1-$0,10225(&2521$'26721(352'8&76*528763(&7580&(0(176%5$=26%52:1*528763(&7580&(0(176%5$=26%52:1*528763(&7580&(0(176%5$=26%52:1'5<67$&.(''5$:1%<&+(&.('%<352-(&712:RRGDOO5RGJHUV)UHHZD\6XLWH0DLQ'DOODV7H[DVZZZRPQLSODQFRP&RS\ULJKW1XPEHU5HYLVLRQ'DWH'?5HYLW?GRFV?48(67&$5(B&RSSHOOBDDGOHU#RPQLSODQFRPUYW 30 $%8,/',1*(/(9$7,216&KHFNHU$XWKRU72'',17(5(676//&48(67&$5(&/,1,&35(6(17$7,2121/<7+,6'5$:,1*,6,1352*5(66$1',6)25,17(5,05(9,(:21/<,7,6127)255(*8/$725<$33529$/3(50,77,1*25&216758&7,211$0(-7,3721+286(:5,*+77(;5(*'$7(6&$/( ($67(/(9$7,216&$/( 6287+(/(9$7,216&$/( :(67(/(9$7,216&$/( 1257+(/(9$7,21(;7(5,250$7(5,$/6&+('8/(*(1(5$/127(6 $//(,)672+$9($'5$,1$*(3/$1(6<67(07<3,&$/)25$//(/(9$7,216 $//+9$&(48,30(176+$//%(522)02817('$1'6&5((1('%<3$5$3(769,67$5,'*(7+(3/$=$$''7 1/275%/2&.'$&5(6=21('3'5+&$%675$&7&233(//'$//$6(;+,%,7' 72& &$17,/(9(5(':$//725(&(,9(6,*1$*(/(77(56a6)121,//80,1$7(',1',9,'8$//<02817('&+$11(/6,*1$*(/(77(56&$676721(:$//%(<21'6.6LP'$6+('/,1('(127(60$;,080(;7(1762)6,*1$*($5($72&522) ()&$676721(:$//121,//80,1$7(',1',9,'8$//<02817('&+$11(/6,*1$*(/(77(5602817('',5(&7/<72&$676721( (4 (4'$6+('/,1('(127(60$;,080(;7(1762)6,*1$*($5($*(1(5$/6,*1$*(127(6 727$/648$5()227$*(2)6,*1$*(,6 6,*1$*(,672%(,//80,1$7('%<67$.(02817('/,*+7,1*/2&$7(',1/$1'6&$3,1*125$&(:$<25:,5(:$<,65(48,5(' +6678%(5()6758&785(&)0),1),//:6&5$7&+&2$7$1'0(7$//$7+*5281'/(9(/&$676721(121,//80,1$7(',1',9,'8$//<02817('&+$11(/6,*1$*(/(77(56:($7+(55(6,67,9(%$55,(5,1',9,'8$//<02817('/2*26,*1$*(,1',9,'8$//<02817('&+$11(/6,*1$*(/(77(56'(37+0,1'5$:1%<&+(&.('%<352-(&712:RRGDOO5RGJHUV)UHHZD\6XLWH0DLQ'DOODV7H[DVZZZRPQLSODQFRP&RS\ULJKW1XPEHU5HYLVLRQ'DWH'?5HYLW?GRFV?48(67&$5(B&RSSHOOBDDGOHU#RPQLSODQFRPUYW $0 6.6,*1$*((/(9$7,216&KHFNHU$XWKRU72'',17(5(676//&48(67&$5(&/,1,&35(6(17$7,2121/<7+,6'5$:,1*,6,1352*5(66$1',6)25,17(5,05(9,(:21/<,7,6127)255(*8/$725<$33529$/3(50,77,1*25&216758&7,211$0(-7,3721+286(:5,*+77(;5(*'$7(6&$/( 6,*1$*((/(9$7,21$6)6&$/( 6,*1$*((/(9$7,21%6)9,67$5,'*(7+(3/$=$$''7 1/275%/2&.'$&5(6=21('3'5+&$%675$&7&233(//'$//$66&$/( &$17/(9(56,*16(&7,216&$/( /2*2EXHIBIT "("6,*1$*( '5$:1%<&+(&.('%<352-(&712:RRGDOO5RGJHUV)UHHZD\6XLWH0DLQ'DOODV7H[DVZZZRPQLSODQFRP&RS\ULJKW1XPEHU5HYLVLRQ'DWH'?5HYLW?GRFV?48(67&$5(B&RSSHOOBDDGOHU#RPQLSODQFRPUYW $0 6.%8,/',1*3(563(&7,9(6&KHFNHU$XWKRU72'',17(5(676//&48(67&$5(&/,1,&35(6(17$7,2121/<7+,6'5$:,1*,6,1352*5(66$1',6)25,17(5,05(9,(:21/<,7,6127)255(*8/$725<$33529$/3(50,77,1*25&216758&7,211$0(-7,3721+286(:5,*+77(;5(*'$7(9,67$5,'*(7+(3/$=$$''7 1/275%/2&.'$&5(6=21('3'5+&$%675$&7&233(//'$//$63(563(&7,9(1257+:(679,(:3(563(&7,9(6287+9,(:3(563(&7,9(6287+:(679,(:3(563(&7,9(1257+($679,(:&9)*#*5'3&/%&3*/(4 ! !"#$%& !"#' ("# $#% # # ##)#"*+ #)#" &&)) # ,, & # '%# - & .)% #) /#0)##1/ 2''-- & .)% 3 #)#"14#"5%/ &2''-6##2 &#% ')) #')-)"4 &&1)7% 2''-6## 2 &#%')) #')) #-)"4 &&1)7% &# %4##2 &#%% %%142%).)%#% & )%6)#174 % #(1 / % 1% # )#%8% )&%/% %4 /2))#2)9#%4 )3)#" %4: % )"# ! # (#%# :& /0)##1/4);)%!<" 21)%) #/4);)%0.)%#/ 4);)%2%)#/4);)%2<#1 #/4);)%=)%= #/4);)%= )1#%4= #/4);)%>.)"# 1 "/ '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # ! ,,##)#"*+ #)#" &&)) # %4;)1 -)#"# ! ,,)% #1) ( ,(,)% #1) -+, )% ! #) /#0)##1/ 2''-- & .)%3 #)#"14#" 5%/ &2''-6##2 &#%')) #')-)"4 &&1)7% 2''-6##2 &#%')) #')) #-)"4 &&1)7% &#%4##2 &#%% %%142%).)%#% &)%6)#174 % #(1 / % 1% # )#%8% )&%/% %4 /2))#2)9#%4 )3)#"%4: % )"# .&& ! $%#&# 0# 01% ; %4 )% #1) ##)& 2''- - & .)% )%4 )#1 % .1 (67 1 ? % & %4# & #)% 1 ;@1% % %4 1 #)%) # 1 &&# ; %4 ##)#" # + #)#" &&)) # 4 )1; 1 #)%) #4;#)#1 %)#% %4 )##1 0# .%&; %4 ##)#" # + #)#" &&)) # ##)& 1 &&# /2''- - & .)% )%4 )#1 % .1 ;@1%% %4/ )#"1 #)%) #A 4) % )#% ;%%% )#1&#% //)1 $&1% !#) ;)#" ;&)%% ) % ;&)) # / '% % %&)# )/ 1%) ##67 );5) ( .)"#% ;1 &)#% )%4%4 )) # /%4.)"#0)##1 !)%) # 1 &&#% ) ; "#% % %4 %)& / 2%) #")#)#" ) # ))#"&)%) / %# .# 0 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference:Consider approval of an ordinance for PD-221R9R2-HC, to amend the Planned Development to attach a Detail Site Plan to allow a 129-room suite (residence) hotel, with a variance to Sec. 12-30-18. (2) c. Not more than 22 room units per acre, and authorizing the Mayor to sign. 2030: Business Prosperity Executive Summary: The subject tract was designated as a future hotel site in the Concept Plan when a Detail Plan for the TRU hotel was approved on the lot abutting to the south. This proposed 129 room Homewood Suites Hotel meets all the requirements of the Hotel Ordinance, except for the additional acreage/density requirement for Residence Hotels and received the variance to Sec. 12-30-18. (2) c. Not more than 22 room units per acre, when approved by City Council on October 9, 2018 Introduction: Per the regulations of the Hotel Ordinance a Homewood Suites Hotel is classified as a Residence Hotel which is defined as: “A multi-dwelling, extended stay lodging facility consisting of efficiency units or suites with a complete kitchen (which are defined as containing a stove top and oven and full size refrigerator) suitable for long-term occupancy. Customary hotel services such as linens, maid service and telephone are provided.” This Homewood Suites complies or exceeds all requirements of the Hotel Ordinance, except for Sec. 12- 30-18. (2) c. Not more than 22 room units per acre. Analysis: On October 9, 2018, the City Council unanimously approved PD-221R9R2-HC, Homewood Suites, with a variance to Sec. 12-30-18.(2) c. Not more than 22 room units per acre, subject to the conditions as recommended by the Planning and Zoning Commission. The applicable conditions have been incorporated into the ordinance. On September 20, 2018, the Planning and Zoning Commission unanimously recommended approval of PD-221R9R2-HC, Homewood Suites, with a variance to Sec. 12-30-18.(2) c. Not more than 22 room units per acre., subject to the following conditions: 1. This property will need to be replatted to provide necessary easements. 2 2. Traffic Impact Analysis being submitted prior to submission of a Replat to determine if deceleration lane(s) will be required. 3. Signs to be compliant with the provisions of the Sign Ordinance 4. Additional comments will be generated at the time of Detail Engineering review and Building Permit review. Legal Review: The City Attorney reviewed this ordinance. Fiscal Impact: None Recommendation: The Planning Department recommended DENIAL of PD-221R9R2-HC, Homewood Suites, due to noncompliance with Sec. 12-30-18.(2) c. Not more than 22 room units per acre. Attachments: 1. Ordinance 2. Exhibit A – Legal Description 3. Exhibit B - Overall Site Plan 4. Exhibit C - Detailed Site Plan 5. Exhibit D - Landscape Plan 6. Exhibit E - First Floor Plan 7. Exhibit F -Typical 2nd-5th Floor Plan 8. Exhibit G - Building Elevations Sign Package (5 pages) City of Coppell Ordinance Pg 1 TM103756 AN ORDINANCE OF THE CITY OF COPPELL, TEXAS ORDINANCE NO. ________ AN ORDINANCE OF THE CITY OF COPPELL, TEXAS, AMENDING THE COMPREHENSIVE ZONING ORDINANCE AND MAP OF THE CITY OF COPPELL, TEXAS, AS HERETOFORE AMENDED, BY GRANTING A CHANGE IN A ZONING FROM PD-221R9R-HC (PLANNED DEVELOPMENT-221 REVISION 9 REVISED-HIGHWAY COMMERCIAL) TO PD-221R9R2-HC (PLANNED DEVELOPMENT-221 REVISION 9 REVISION 2-HIGHWAY COMMERCIAL) TO AMEND THE PLANNED DEVELOPMENT TO ATTACH A DETAIL SITE PLAN TO ALLOW A 129 ROOM RESIDENCE HOTEL ON 3.024 ACRES OF PROPERTY LOCATED ON POINT WEST BOULEVARD, APPROX. 110 FEET SOUTH OF DIVIDEND DRIVE, AND BEING MORE PARTICULARLY DESCRIBED IN EXHIBIT “A” ATTACHED HERETO AND INCORPORATED HEREIN; PROVIDING FOR APPROVAL OF THE OVERALL SITE PLAN, DETAIL SITE PLAN, FIRST FLOOR PLAN AND TYPICAL UPPER FLOOR PLANS, LANDSCAPE PLAN, BUILDING ELEVATIONS AND SIGNAGE ATTACHED HERETO AS EXHIBITS “B” THROUGH “G”; AND PROVIDING FOR DEVELOPMENT REGULATIONS; PROVIDING A REPEALING CLAUSE; PROVIDING A SEVERABILITY CLAUSE; PROVIDING A SAVINGS CLAUSE; PROVIDING A PENALTY OF FINE NOT TO EXCEED THE SUM OF TWO THOUSAND DOLLARS ($2,000.00) FOR EACH OFFENSE; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City Planning and Zoning Commission and the governing body of the City of Coppell, Texas, in compliance with the laws of the State of Texas and pursuant to the Comprehensive Zoning Ordinance of the City of Coppell, have given requisite notices by publication and otherwise, and after holding due hearings and affording a full and fair hearing to all property owners generally, and to all persons interested and situated in the affected area and in the vicinity thereof, the said governing body is of the opinion that Zoning Application No. PD-221R9R2-HC should be approved, and in the exercise of legislative discretion have concluded that the Comprehensive Zoning Ordinance and Map should be amended. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF COPPELL, TEXAS: SECTION 1. That the Comprehensive Zoning Ordinance and Map of the City of Coppell, Texas, duly passed by the governing body of the City of Coppell, Texas, as heretofore amended, be and the same is hereby amended by granting a change in zoning from PD-221R9R-HC (Planned Development-221Revision 9 Revised-Highway Commercial) to PD-221R9R2-HC (Planned Development-221 Revision 9 Revision 2-Highway Commercial), to amend the Planned Development to attach a Detail Site Plan to allow a 129 room residence hotel, as defined in the City of Coppell Ordinance Pg 2 TM103756 Code of Ordinances, on 3.024 acres of property located on Point West Boulevard, approximately 110 feet south of Dividend Drive, for the property described in Exhibit “A” attached hereto and made a part hereof for all purposes. SECTION 2. That the Property will be used and developed for Highway Commercial, including a Residence Hotel, purposes as provided in the Code of Ordinances, is hereby approved subject to the following development regulations: A. As indicated in attached Exhibits, this Residence Hotel shall meet the following development regulations: i. There shall be a minimum of 129 guest rooms; ii. the minimum guest room size shall be at least 459 square feet; iii. the lobby/waiting/atrium area shall be a minimum of 966 square feet; iv. there shall be a dedicated meeting room space of at least 1,200 square feet. v. there shall be a limited food service/restaurant defined such as a self-serve food and beverages bar available for guests with a common seating area/tables for consumption with or without servers. vi. there shall be outdoor plaza or patio area and shall be a minimum of 1,200 square feet as depicted in approved Detail Site Plan, Exhibit B. vii. There shall be an outdoor swimming pool with a minimum of 800 square feet of water surface area as depicted in Exhibit B. viii. The equipped weight or fitness room shall be a minimum of 700 square feet. B. There shall be a minimum separation of 1,500 feet from any other residence hotel. C. Compliance with Sec. 12-30-18. (2), except the room to acre density; 12-30-18(2)(c). D. This property shall be replatted to provide a building sites, utilities, easements and fire lanes prior to the issuance of a Building Permit. City of Coppell Ordinance Pg 3 TM103756 E. Traffic Impact Analysis shall be submitted prior to submission of a Replat to determine if deceleration lane(s) will be required. F. Signs to be compliant with the provisions of the Sign Ordinance. SECTION 3. That the Concept Site Plan, Detail Site Plan, First Floor and Upper Floor Plans, Landscape Plan, Building Elevations and Sign Plan, attached hereto as Exhibits “B” through “F”; respectively shall be deemed as development regulations to this development. SECTION 4. That the above property shall be used only in the manner and for the purpose provided for by the Comprehensive Zoning Ordinance of the City of Coppell, as heretofore amended, and as amended herein. SECTION 5. That the development of the property herein shall be in accordance with building regulations, zoning ordinances, and any applicable ordinances except as may be specifically altered or amended herein. SECTION 6. That all provisions of the Ordinances of the City of Coppell, Texas, in conflict with the provisions of this ordinance be, and the same are hereby, repealed, and all other provisions not in conflict with the provisions of this ordinance shall remain in full force and effect. SECTION 7. That should any sentence, paragraph, subdivision, clause, phrase or section of this ordinance be adjudged or held to be unconstitutional, illegal or invalid, the same shall not affect the validity of this ordinance as a whole, or any part or provision thereof other than the part so decided to be unconstitutional, illegal or invalid, and shall not affect the validity of the Comprehensive Zoning Ordinance as a whole. SECTION 8. An offense committed before the effective date of this ordinance is governed by prior law and the provisions of the Comprehensive Zoning Ordinance, as amended, in effect when the offense was committed and the former law is continued in effect for this purpose. SECTION 9. That any person, firm or corporation violating any of the provisions or terms of this ordinance shall be subject to the same penalty as provided for in the Comprehensive Zoning City of Coppell Ordinance Pg 4 TM103756 Ordinance of the City of Coppell, as heretofore amended, and upon conviction shall be punished by a fine not to exceed the sum of Two Thousand Dollars ($2,000.00) for each offense; and each and every day such violation shall continue shall be deemed to constitute a separate offense. SECTION 10. That this ordinance shall take effect immediately from and after its passage and the publication of its caption, as the law and charter in such cases provide. DULY PASSED by the City Council of the City of Coppell, Texas, this the _______ day of ___________________, 2018. APPROVED: _____________________________________ KAREN SELBO HUNT ATTEST: ___________________________________ CHRISTEL PETTINOS, CITY SECRETARY APPROVED AS TO FORM: ________________________________ CITY ATTORNEY Exhibit“A” Legal Description Being a 3.02 acre tract of land situated in the Cordelia Bowen Survey, Abstract No. 56, in the City of Coppell. Dallas County, Texas; being a part of that certain 8.221 acre tract of land described In a Special Warranty Deed to Trophy Lodging LTD by deed in Instrument No. 201500272307, Official Public Records of Dallas County, Texas; said 3.02 acre tract being more particularly described as follows: COMMENCING at a 5/8 Inch iron rod wlth "JDJR" cap found at the southwest comer of said Trophy Lodging LTD tract, said point being the northwest corner of Lot 2R, Block C, Duke Lesley Addition, an addition to the City of Coppell, Dallas County, Texas, according to the plat thereof recorded In Document No. 201400082516, Official Public Records, Dallas County, Texas. same point being In the east line of Point West Boulevard (a 50.0 foot wide right of way), said point being the southwest comer of Lot 4, Block C, Duke Lesley Addition, an addition to the City of Coppell, Dallas County, Texas, according to the plat thereof recorded in Document No. 201600339775. Official Public Records. Dallas County, Texas, said point also being the beginning of a non-tangent curve to the left, having a radius of 475.00 feet, delta angle of 28 degrees 49 minutes 34 seconds, and a chord bearing and distance of North 30 degrees 35 minutes 13 seconds West. 236.47 feet. THENCE In a northwesterly direction along said curve to the left and along the east line of said Point West Boulevard, an arc distance of 238.98 feet to a 1/2 inch iron rod with "Pacheco Koch" cap found for corner: THENCE North 45 degrees 00 minutes 00 seconds West, continuing along the east line of said Point West Boulevard, a distance of 69.44 feet to a 1/2 Inch Iron rod with "Pacheco Koch" cap found for corner, said point also being the beginning of a curve to the right having a radius of 425.00 feet, a delta angle of 11 degrees 33 minutes 16 seconds, and a chord bearing and distance of North 39 degrees 13 minutes 22 seconds West, 85.56 feet THENCE In a northwesterly direction along said curve to the right and along the east line of said Point West Boulevard, an arc distance of 85.71 feet to a 1/2 inch iron rod set for corner, said point being the POINT of BEGINNING,same point being the southwest corner of said 3.02 acre tract of land being described, same point being the southwest corner of said 3.02 acre tract of land being described, said point also being the beginning of a curve to the right having a radius of 425.00 feet, a delta angle of 33 degrees 29 minutes 11 seconds, and a chord bearing and distance of North 16 degrees 42 minutes 08 seconds West. 244.87 feet THENCE In a northwesterly direction along said curve to the right and along the east line of said Point West Boulevard, an arc distance Of 248.39 feet to a 1/2 Inch Iron rod with ''Pacheco Koch" cap found for comer; THENCE North 89 degrees 57 minutes 33 seconds West a distance of 583.68 feet; point being the northeast corner of said 3.02 acre tract of land being described, same point being along the shared property line of Lot 3R. Block C of Duke Lesley Addition, an addition to the City of Coppell, Dallas County, Texas,according to the plat thereof recorded in Document No. 200900210489, Official Public Records, Dallas County Texas; THENCE South 00 degrees 02 minutes 27 seconds West, along the common line of said 3.02 acre tract of land being described and said Lot 3R, Block C, a distance of 234.49 feet to a 1/21nch Iron rod set for corner, said point being the southeast comer of said 3.02 acre tract of land being described, same point being the northeast corner of said Lot 4, Block C; THENCE North 89 degrees 57 minutes 33 seconds West, continuing along the common line of said Lot 4, Block C and said 3.02 acre tract of land being described, a distance of 513.14 feet to the POINT of BEGINNING and containing 131,549.66 square feet or 3.02 acres of computed land. &YIJCJU# &YIJCJU$ MT 15' LANDSCAPE ESMT 10' LANDSCAPE ESMTSCREENEDDUMPSTER513.14'20' BLDG LINEOPSPORT COURT60' BLD G LI N E 10' LANDSCAPE ESMT20' BLDG LINE20' BLDG LINE15' LAN D S C A P E E S M T10' LANDSCAPE ESMT20' BLDG LINESCREENED DUMPSTER 583.67'235.00'(800 SF WATERSURFACE AREA)FENCED OUTDOOR POOL750 S.F.TFFE=536.15HOMEWOOD SUITESHYDSS00°02'27"W 785.00'VVV1/2" IRFCR=425.00'L=334.10'D=45°02'27"CB=N22°28'47"WCL=325.56'532532533 533534 534534534534534 53535535535535535535 535 535 535535535536536536536 536POINT WEST B O U L E V A R D (A 50.0 FOOT W I D T H R . O . W . )Sheet Title:Date:Project Number:Sheet Number:Drawn By:18002Revisions:Date Issued: Description:May 2018awrEngineer Information:#Professional of Record:The Bousquet Group, Inc.505 Simmons StreetDenton, TX. 76205940.566.0088940.566.0008 faxScale:HOMEWOOD SUITESPOINT WEST BLVD.COPPELL, TEXASTexas Firm No. F-89421" = 30'aW RAWR Designs, LLCP.O. Box 1746Aledo, Texas 76008amanda@awr-designs.comc. 512.517.558905/22/2018 D.A.C. Meeting108/20/2018 City Pre-Submittal Review2PROGRESS SET - FOR REVIEW ONLYISSUEDThese documents areNOT FOR REGULATORY APPROVAL,PERMITTING OR CONSTRUCTION.They were prepared by,or under the supervision of:Amanda W. Richardson TX Registered Landscape Architect#27548.22.18LANDSCAPE PLANL1.01GRAPHIC SCALEFEET06030Scale 1"=30' - 0"GENERAL LAWN NOTESEROSION CONTROL AND SOIL PREPARATION:THE CONTRACTOR IS RESPONSIBLE FOR MAINTAINING TOP SOIL AT THE CORRECT GRADES. CONTRACTOR TOFINE GRADE AREAS TO REACH FINAL CONTOURS AS SPECIFIED PER CIVIL PLANS. ALL CONTOURS SHOULDACHIEVE POSITIVE DRAINAGE AWAY FROM BUILDINGS AND STRUCTURES. WATER SHOULD NOT BE ABLE TOPOOL IN ANY AREAS UNLESS SPECIFIED OTHERWISE. EROSION FABRIC SUCH AS JUTE MATTING OR OPENWEAVE TO BE USED WHERE NECESSARY TO PREVENT SOIL EROSION.ANY LOSS OF TOPSOIL OR GRASS DUE TO EROSION IS THE RESPONSIBILITY OF THE CONTRACTOR UNTIL IT IS100% ESTABLISHED.CONTRACTOR TO REMOVE ANY ROCKS 3/4" AND LARGER, STICKS AND DEBRIS PRIOR TO INSTALLATION OFTOPSOIL AND SOD.FOUR (4") OF TOPSOIL SHALL BE APPLIED TO AREAS DISTURBED BY CONSTRUCTION RECEIVING SOD. IFTOPSOIL IS NOT AVAILABLE ON SITE, THE CONTRACTOR SHALL PROVIDE TOPSOIL AS APPROVED BY THEOWNER OR OWNERS REPRESENTATIVE.TOPSOIL SHALL BE FRIABLE, NATURAL LOAM, FREE OF ROCKS, WEEDS, BRUSH, CLAY LUMPS, ROOTS, TWIGS,LITTER AND ENVIRONMENTAL CONTAMINANTS.CONTRACTOR SHALL BE RESPONSIBLE FOR SOD UNTIL ACCEPTANCE. THIS SHALL INCLUDE, BUT NOT BELIMITED TO: MOWING, WATERING, WEEDING, CULTIVATING, CLEANING AND REPLACING DEAD OR BARE AREASTO KEEP PLANTS IN A VIGOROUS, HEALTHY CONDITION. SOD SHALL BE REPLACED IF NECESSARY.SOLID SOD:SOLID SOD SHALL BE PLACED ALONG ALL IMPERVIOUS EDGES, AT A MINIMUM. THIS SHALL INCLUDE CURBS,WALKS, INLETS, MANHOLES AND PLANTING BED AREAS. SOD SHALL COVER OTHER AREAS COMPLETELY ASINDICATED BY PLAN.SOD SHALL BE STRONGLY ROOTED DROUGHT RESISTANT SOD, NOT LESS THAN 2 YEARS OLD, FREE OFWEEDS AND UNDESIRABLE NATIVE GRASS AND MACHINE CUT TO PAD THICKNESS OF 3/4" (+1/4"), EXCLUDINGTOP GROWTH AND THATCH. PROVIDE ONLY SOD CAPABLE OF VIGOROUS GROWTH AND DEVELOPMENT WHENPLANTED.DO NOT INSTALL SOD IF IT IS DORMANT OR GROUND IS FROZEN. LAY SOD WITH TIGHTLY FITTING JOINTS, NOOVERLAPS WITH STAGGERED STRIPS TO OFFSET JOINTS.SOD SHALL BE ROLLED TO CREATE A SMOOTH EVEN SURFACE. SOD SHOULD BE WATERED THOROUGHLYDURING INSTALLATION PROCESS.SHOULD INSTALLATION OCCUR BETWEEN OCTOBER 1ST AND MARCH 1ST, SOD SHALL INCLUDE ANOVER-SEED OF ANNUAL RYE OR WINTER RYEGRASS AT A RATE OF FOUR POUNDS PER ONE THOUSANDSQUARE FEET FOR A GROWN-IN APPEARANCE. CONTRACTOR SHALL ENSURE CONFORMANCE TO §115.D OFTITLE 7, PART XXIX, HORTICULTURE COMMISSION CHAPTER 1.HYDROMULCH:SCARIFY SURFACE TO A MINIMUM OF 2" DEPTH PRIOR TO THE IMPORT TOPSOIL APPLICATION. TOP SOILSHALL BE PLACED 2" IN DEPTH IN ALL AREAS TO BE SEEDED. CONTRACTOR TO SUPPLY HIGH QUALITYIMPORTED TOPSOIL HIGH IN HUMAS AND ORGANIC CONTENT FROM A LOCAL SUPPLY. IMPORTED TOPSOILSHALL BE REASONABLY FREE OF CLAY LUMPS, COARSE SANDS, STONES, ROOTS AND OTHER FOREIGNDEBRIS.IF INADEQUATE MOISTURE IS PRESENT IN SOIL, APPLY WATER AS NECESSARY FOR OPTIMUM MOISTUREFOR SEED APPLICATION.ALL SEED SHALL BE HIGH QUALITY, TREATED LAWN TYPE SEED AND IS FREE OF NOXIOUS GRASS SEEDS.THE SEED APPLICATION SHALL BE UNIFORMLY DISTRIBUTED ON THE AREAS INDICATED ON PLANS.HYDROMULCH WITH BERMUDA GRASS SEED AT A RATE OF TWO POUNDS PER ONE THOUSAND SQUAREFEET.IF INSTALLATION OCCURS BETWEEN OCTOBER 1ST AND APRIL 1ST, ALL HYDORMULCH AREAS SHALL BEOVER-SEEDED WITH ANNUAL RYE GRASS AT A RATE OF FOUR POUNDS PER ONE THOUSAND SQUAREFEET. CONTRACTOR TO RE-HYDROMULCH WITH BERMUDA GRASS AT THE END OF THE ANNUAL RYEGROWING SEASON.AFTER APPLICATION, NO EQUIPMENT SHALL OPERATE OVER APPLIED AREAS. WATER SEEDED AREASIMMEDIATELY AFTER INSTALLATION TO SATURATION.ALL LAWN AREAS TO BE HYDROMULCHED SHALL ACHIEVE 100% COVERAGE PRIOR TO FINALACCEPTANCE.LANDSCAPE NOTESREFERENCE SITEWORK AND SPECIFICATIONS FOR INFORMATION NEEDED FOR LANDSCAPE WORK.CONTRACTOR TO VERIFY AND LOCATE ALL PROPOSED AND EXISTING STRUCTURES. NOTIFY LANDSCAPEARCHITECT OR DESIGNATED REPRESENTATIVE FOR ANY LAYOUT DISCREPANCIES OR ANY CONDITION THATWOULD PROHIBIT THE INSTALLATION AS SHOWN.CONTRACTOR SHALL CALL 811 TO VERIFY AND LOCATE ANY AND ALL UTILITIES ON SITE PRIOR TOCOMMENCING WORK. LANDSCAPE ARCHITECT SHOULD BE NOTIFIED OF ANY CONFLICTS.A MINIMUM OF 2% SLOPE SHALL BE PROVIDED AWAY FROM ALL STRUCTURES.LANDSCAPE ISLANDS SHALL BE CROWNED, AND UNIFORM THROUGHOUT THE SITE.ALL PLANTING AREAS SHALL BE GRADED SMOOTH TO ACHIEVE FINAL CONTOURS AS INDICATED ON PLANWITH 3" OF TOPSOIL AND 3" OF COMPOST AND CONSISTENTLY BLENDED TO A DEPTH OF 9". ALL BEDS SHALLBE CROWNED TO ANTICIPATE SETTLEMENT AND ENSURE PROPER DRAINAGE.PLANTING AREAS AND SOD TO BE SEPARATED BY STEEL EDGING. EDGING TO BE GREEN IN COLOR AND AMINIMUM OF 3/16" THICK. EDGING SHALL BE STAKED FROM THE INSIDE OF BED. EDGING NOT TO BE MORETHAN 1/2" ABOVE FINISHED GRADE.MULCH SHALL BE INSTALLED AT 1/2" BELOW THE TOPS OF SIDEWALKS AND CURBING.QUANTITIES ON THESE PLANS ARE FOR REFERENCE ONLY. THE SPACING OF PLANTS SHOULD BE ASINDICATED ON PLANS OR OTHERWISE NOTED. ALL TREES AND SHRUBS SHALL BE PLANTED PER DETAILS.CONTAINER GROWN PLANT MATERIAL IS PREFERRED HOWEVER BALL AND BURLAP PLANT MATERIAL CAN BESUBSTITUTED IF NEED BE AND IS APPROPRIATE TO THE SIZE AND QUALITY INDICATED ON THE PLANTMATERIAL LIST.TREES SHALL BE PLANTED AT A MINIMUM OF 5' FROM ANY UTILITY LINE, SIDEWALK OR CURB. TREES SHALLALSO BE 10' CLEAR FROM FIRE HYDRANTS.4" OF SHREDDED HARDWOOD MULCH (2" SETTLED THICKNESS) SHALL BE PLACED OVER 4.1 OZ WOVEN, WEEDBARRIER FABRIC OR APPROVED EQUAL. WEED BARRIER FABRIC SHALL BE USED IN PLANT BEDS AND AROUNDALL TREES AND SHALL BE DE WITT 'WEED BARRIER' OR APPROVED EQUAL. MULCH SHALL BE SHREDDED BARKOR RUBBER LANDSCAPE MULCH, PINE STRAW MULCH IS PROHIBITED.CONTRACTOR TO PROVIDE UNIT PRICING OF LANDSCAPE MATERIALS AND BE RESPONSIBLE FOR OBTAININGALL LANDSCAPE AND IRRIGATION PERMITS.IRRIGATION:IN THE ABSENCE OF AN IRRIGATION SYSTEM OR AREAS BEYOND THE COVERAGE LIMITS OF A PERMANENTIRRIGATION SYSTEM, CONTRACTOR SHALL WATER SOD TEMPORARILY, BY ANY MEANS AVAILABLE, TODEVELOP ADEQUATE GROWTH. TURF SHALL BE IN 100% ESTABLISHMENT AT THE TIME OF ACCEPTANCE.ALL PLANTING BEDS SHALL HAVE AN AUTOMATIC IRRIGATION SYSTEM WITH A FREEZE/RAIN SENSOR. SYSTEMSHALL ALSO HAVE AN ET WEATHER BASED CONTROLLER AND BE DESIGNED AND INSTALLED BY A LICENSEDIRRIGATOR.MAINTENANCE REQUIREMENTS:VEGETATION SHOULD BE INSPECTED REGULARLY TO ENSURE THAT PLANT MATERIAL IS ESTABLISHINGPROPERLY AND REMAINS IN A HEALTHY GROWING CONDITION APPROPRIATE FOR THE SEASON. IFDAMAGED OR REMOVED, PLANTS MUST BE REPLACED BY A SIMILAR VARIETY AND SIZE.MOWING, TRIMMING, EDGING AND SUPERVISION OF WATER APPLICATIONS SHALL BE THE RESPONSIBILITYOF THE CONTRACTOR UNTIL THE OWNER OR OWNER'S REPRESENTATIVE ACCEPTS AND ASSUMESREGULAR MAINTENANCE.ALL LANDSCAPE AREAS SHOULD BE CLEANED AND KEPT FREE OF TRASH, DEBRIS, WEEDS AND OTHERMATERIAL.MISCELLANEOUS MATERIALS:STEEL EDGING SHALL BE 3/16" X 4 X 16' DARK GREEN DURAEDGE STEEL LANDSCAPE EDGING.PD# 221R9R2-HC&YIJCJU% Sheet Title:Date:Project Number:Sheet Number:Drawn By:18002Revisions:Date Issued: Description:May 2018awrEngineer Information:#Professional of Record:The Bousquet Group, Inc.505 Simmons StreetDenton, TX. 76205940.566.0088940.566.0008 faxScale:HOMEWOOD SUITESPOINT WEST BLVD.COPPELL, TEXAS05/17/18Texas Firm No. F-89421" = 30'aW RAWR Designs, LLCP.O. Box 1746Aledo, Texas 76008amanda@awr-designs.comc. 512.517.558905/22/2018 D.A.C. Meeting108/20/2018 City Pre-Submittal Review2LANDSCAPE SPECIFICATIONSL1.03AND DETAILSSECTION 32 9300 - LANDSCAPEPART 1 - GENERAL1.1 QUALIFICATIONS OF THE LANDSCAPE CONTRACTOR.A. ALL LANDSCAPE WORK SHOWN ON THESE PLANS SHALL BEPERFORMED BY A SINGLE FIRM SPECIALIZING IN LANDSCAPEPLANTING1.2 REFERENCE DOCUMENTSA. REFER TO LANDSCAPE PLANS, NOTES, AND DETAILS FORADDITIONAL REQUIREMENTS1.3 SCOPE OF WORK / DESCRIPTION OF WORKA. WORK COVERED BY THESE SECTIONS INCLUDES THE FURNISHINGAND PAYMENT OF ALL MATERIALS, LABOR, SERVICES, EQUIPMENT,LICENSES, TAXES AND ANY OTHER ITEMS THAT ARE NECESSARY FORTHE EXECUTION, INSTALLATION AND COMPLETION OF ALL WORK,SPECIFIED HEREIN AND / OR SHOWN ON THE LANDSCAPE PLANS,NOTES, AND DETAILS.B. ALL WORK SHALL BE PERFORMED IN ACCORDANCE WITH ALLAPPLICABLE LAWS, CODES AND REGULATIONS REQUIRED BYAUTHORITIES HAVING JURISDICTION OVER SUCH WORK, INCLUDINGALL INSPECTIONS AND PERMITS REQUIRED BY FEDERAL, STATE ANDLOCAL AUTHORITIES IN SUPPLY, TRANSPORTATION ANDINSTALLATION OF MATERIALS.C. THE LANDSCAPE CONTRACTOR SHALL VERIFY THE LOCATION OF ALLUNDERGROUND UTILITY LINES (WATER, SEWER, ELECTRICAL,TELEPHONE, GAS, CABLE, TELEVISION, ETC.) PRIOR TO THE STARTOF ANY WORKD. FURNISH ALL LABOR, MATERIALS, EQUIPMENT, AND SERVICESNECESSARY TO PROVIDE ALL WORK, COMPLETE IN PLACE ASSHOWN AND SPECIFIED. WORK SHOULD INCLUDE:E. PLANTING OF TREES, SHRUBS AND GRASSESA. SEEDINGB. BED PREPARATION AND FERTILIZATIONC. WATER AND MAINTENANCE UNTIL FINAL ACCEPTANCED. WORK GUARANTEE1.4 REFERENCESA. AMERICAN NATIONAL STANDARDS INSTITUTE (ANSI) Z60.1 - NURSERYSTOCKB. TEXAS STATE DEPARTMENT OF AGRICULTUREC. TEXAS ASSOCIATION OF NURSERYMEN, GRADES AND STANDARDS1.5 SUBMITTALSA. PROVIDE REPRESENTATIVE QUANTITIES OF EACH SOIL, MULCH, BEDMIX, GRAVEL AND STONE BEFORE INSTALLATION. SAMPLES TO BEAPPROVED BY OWNER'S REPRESENTATIVE BEFORE USE.B. SOIL AMENDMENTS AND FERTILIZERS SHOULD BE RESEARCHEDAND BASED ON THE SOILS IN THE AREA.C. BEFORE INSTALLATION, SUBMIT DOCUMENTATION THAT PLANTMATERIALS ARE AVAILABLE AND HAVE BEEN RESERVED. FOR ANYPLANT MATERIAL NOT AVAILABLE, SUBMIT REQUEST FORSUBSTITUTION.1.6 JOB CONDITIONS, DELIVERY, STORAGE AND HANDLINGA. GENERAL CONTRACTOR TO COMPLETE WORK BEFORE LANDSCAPECONTRACTOR TO COMMENCE. ALL PLANTING BED AREAS SHALL BELEFT THREE INCHES BELOW FINAL GRADE OF SIDEWALKS, DRIVESAND CURBS. ALL AREAS TO RECEIVE SOLID SOD SHALL BE LEFT ONEINCH BELOW THE FINAL GRADE OF WALKS, DRIVES AND CURBS.CONSTRUCTION DEBRIS SHALL BE REMOVED PRIOR TO LANDSCAPECONTRACTOR BEGINNING WORK.B. ALL PACKAGED MATERIALS SHALL BE SEALED IN CONTAINERSSHOWING WEIGHT, ANALYSIS AND NAME OF MANUFACTURER. ALLMATERIALS SHALL BE PROTECTED FROM DETERIORATION INTRANSIT AND WHILE STORED ON SITE.C. DELIVER PLANT MATERIALS IMMEDIATELY PRIOR TO INSTALLATION.PLANT MATERIALS SHOULD BE INSTALLED ON THE SAME DAY ASDELIVERED. IF PLANTING CANNOT BE INSTALLED ON THE SAME DAY,PROVIDE ADDITIONAL PROTECTION TO MAINTAIN PLANTS IN AHEALTHY, VIGOROUS CONDITION.D. STORE PLANT MATERIALS IN SHADE, PROTECT FROM FREEZING ANDDRYING.E. KEEP PLANT MATERIALS MOIST AND PROTECT FROM DAMAGE TOROOT BALLS, TRUNKS AND BRANCHES.F. PROTECT ROOT BALLS BY HEELING WITH SAWDUST OR OTHERMOISTURE RETAINING MATERIAL IF NOT PLANTED WITHIN 24 HOURSOF DELIVERY.G. NOTIFY OWNER'S REPRESENTATIVE OF DELIVERY SCHEDULE 72HOURS IN ADVANCE.H. FOR BALLED AND BURLAPPED PLANTS - DIG AND PREPARESHIPMENT IN A MANNER THAT WILL NOT DAMAGE ROOTS,BRANCHES, SHAPE, AND FUTURE DEVELOPMENT.I. CONTAINER GROWN PLANTS - DELIVER PLANTS IN CONTAINER TOHOLD BALL SHAPE AND PROTECT ROOT MASS.J. STORAGE OF ALL MATERIALS AND EQUIPMENT WILL BE AT THE RISKOF THE LANDSCAPE CONTRACTOR. OWNER WILL NOT BE HELDRESPONSIBLE FOR THEFT OR DAMAGE.1.7 SEQUENCINGA. INSTALL TREES, SHRUBS, AND LINER STOCK PLANT MATERIALSPRIOR TO INSTALLATION OF LAWN/SOLID SOD.B. WHERE EXISTING TURF AREAS ARE BEING CONVERTED TO PLANTINGBEDS, THE TURF SHALL BE CHEMICALLY ERADICATED TO MINIMIZERE-GROWTH IN THE FUTURE. AREAS SHALL BE PROPERLY PREPAREDWITH AMENDED ORGANIC MATTER.1.8 WARRANTIES PERIOD, PLANT GUARANTEE, REPLACEMENTSA. PROVIDE A MINIMUM OF (2) COPIES OF RECORD DRAWINGS TO THEOWNER UPON COMPLETION OF WORK. A RECORD DRAWING IS ARECORD OF ALL CHANGES THAT OCCURRED IN THE FIELD AND THATARE DOCUMENTED THROUGH CHANGE ORDERS, ADDENDA, ORCONTRACTOR/CONSULTANT DRAWING MARKUPS.B. FURNISH WRITTEN WARRANTY THAT PLANT MATERIALS WILL BE IN AHEALTHY, VIGOROUS GROWING CONDITION FOR ONE YEAR (TWELVEMONTHS) AFTER FINAL ACCEPTANCE. DAMAGE DUE TO ACTS OFGOD, VANDALISM, OR NEGLIGENCE BY OWNER IS EXCLUDED.C. REPLACE DEAD, UNHEALTHY, AND UNSIGHTLY PLANT MATERIALWITHIN WARRANTY PERIOD UPON NOTIFICATION BY OWNER OROWNER'S REPRESENTATIVE. PLANTS USED FOR REPLACEMENTSHALL BE OF THE SAME SIZE AND KIND AS THOSE ORIGINALLYPLANTED OR SPECIFIED.D. THE OWNER AGREES THAT FOR THE ONE YEAR WARRANTY PERIODTO BE EFFECTIVE, HE WILL WATER PLANTS AT LEAST TWICE A WEEKDURING DRY PERIODS.E. NOTIFY OWNER OR OWNER'S REPRESENTATIVE SEVEN DAYS PRIORTO THE EXPIRATION OF THE WARRANTY PERIOD.A. REMOVE DEAD, UNHEALTHY AND UNSIGHTLY PLANTSB. REMOVE GUYING AND STAKING MATERIALS.1.9 MAINTENANCEA. MAINTAIN PLANT LIFE AND PLANTING BEDS IMMEDIATELY AFTERPLACEMENT AND FOR MINIMUM 30 DAYS AFTER FINAL ACCEPTANCE.B. ALL LANDSCAPE MUST BE MAINTAINED AND GRASS MOWED/EDGEDON A WEEKLY SCHEDULE UNTIL ACCEPTANCE BY OWNER.C. REPLACE DEAD OR DYING PLANTS WITH PLANTS OF SAME SIZE ANDSPECIES AS SPECIFIED.D. REMOVE TRASH, DEBRIS, AND LITTER. WATER, PRUNE, RESTAKETREES, FERTILIZE, WEED AND APPLY HERBICIDES AND FUNGICIDESAS REQUIRED.E. REMOVE CLIPPINGS AND DEBRIS FROM SITE PROMPTLY.F. COORDINATE WITH OPERATION OF IRRIGATION SYSTEM TO ENSURETHAT PLANTS ARE ADEQUATELY WATERED. HAND WATER AREASNOT RECEIVING ADEQUATE WATER FROM AN IRRIGATION SYSTEM.G. THE LANDSCAPE CONTRACTOR SHALL MAINTAIN THE IRRIGATIONSYSTEM IN ACCORDANCE TO THE MAINTENANCE SERVICE TOENSURE THE SYSTEM IS IN PROPER WORKING ORDER WITHSCHEDULING ADJUSTMENTS BY SEASON TO MAXIMIZE WATERCONSERVATION.H. RESET SETTLED PLANTSI. REAPPLY MULCH TO BARE AND THIN AREAS.J. SHOULD SEEDED AND/OR SODDED AREAS NOT BE COVERED BY ANAUTOMATIC IRRIGATION SYSTEM, THE LANDSCAPE CONTRACTORSHALL BE RESPONSIBLE FOR WATERING THESE AREAS ANDOBTAINING A FULL, HEALTHY STAND OF GRASS AT NO ADDITIONALCOST TO THE OWNER.K. TO ACHIEVE FINAL ACCEPTANCE AT THE END OF THE MAINTENANCEPERIOD, ALL OF THE FOLLOWING CONDITIONS MUST OCCUR:a. THE LANDSCAPE SHALL SHOW ACTIVE, HEALTHY GROWTH(WITH EXCEPTIONS MADE FOR SEASONAL DORMANCY). ALLPLANTS NOT MEETING THIS CONDITION SHALL BEREJECTED AND REPLACED BY HEALTHY PLANT MATERIALPRIOR TO FINAL ACCEPTANCE.b. ALL HARDSCAPE SHALL BE CLEANED PRIOR TO FINALACCEPTANCE.c. SODDED AREAS MUST BE ACTIVELY GROWING AND MUSTREACH A MINIMUM HEIGHT OF 1 1/2 INCHES BEFORE FIRSTMOWING. HYDROMULCHED AREAS SHALL SHOW ACTIVE,HEALTHY GROWTH. BARE AREAS LARGER THAN TWELVESQUARE INCHES MUST BE RESODDED OR RESEEDED (ASAPPROPRIATE) PRIOR TO FINAL ACCEPTANCE. ALL SODDEDTURF SHALL BE NEATLY MOWED.1.10 QUALITY ASSURANCEA. COMPLY WITH ALL FEDERAL, STATE, COUNTY AND LOCALREGULATIONS GOVERNING LANDSCAPE MATERIALS AND WORK.B. EMPLOY PERSONNEL EXPERIENCED AND FAMILIAR WITH THEREQUIRED WORK AND SUPERVISION BY A FOREMAN.C. DO NOT MAKE PLANT MATERIAL SUBSTITUTIONS. IF THE LANDSCAPEMATERIAL SPECIFIED IS NOT READILY AVAILABLE, SUBMIT PROOF TOLANDSCAPE ARCHITECT ALONG WITH THE PROPOSED MATERIAL TOBE USED IN LIEU OF THE SPECIFIED PLANT.D. OWNER'S REPRESENTATIVE SHALL INSPECT ALL PLANT MATERIALAND RETAINS THE RIGHT TO INSPECT MATERIALS UPON ARRIVAL TOTHE SITE AND DURING INSTALLATION. THE OWNER'SREPRESENTATIVE MAY ALSO REJECT ANY MATERIALS HE/SHE FEELSTO BE UNSATISFACTORY OR DEFECTIVE DURING THE WORKPROCESS. ALL PLANTS DAMAGED IN TRANSIT OR AT THE JOB SITESHALL BE REJECTED.PART 2 - PRODUCTS2.1 PLANT MATERIALSA. ALL PLANTS SHALL BE CERTIFIED IN ACCORDANCE THE AMERICANSTANDARD FOR NURSERY STOCK.B. ALL TREES SHALL BE OBTAINED FROM SOURCES WITHIN 200 MILESOF THE PROJECT SITE, AND WITH SIMILAR CLIMACTIC CONDITIONS.C. PLANTS SHALL CONFORM TO THE MEASUREMENTS SPECIFIED,EXCEPT THE PLANTS LARGER THAN THOSE SPECIFIED MAY BE USED.USE OF LARGER PLANTS SHALL NOT INCREASE THE CONTRACTPRICE.D. WHERE MATERIALS ARE PLANTED IN MASSES, PROVIDE PLANTS OFUNIFORM SIZE.E. PLANT SCHEDULE ON DRAWING IS FOR CONTRACTOR'SINFORMATION ONLY AND NO GUARANTEE IS EXPRESSED OR IMPLIEDTHAT QUANTITIES THEREIN ARE CORRECT. THE CONTRACTOR SHALLENSURE THAT ALL PLANT MATERIALS SHOWN ON THE DRAWINGSARE INCLUDED IN HIS OR HER BID.F. SHALL BE FREE OF DISEASE, INSECT INFESTATION, DEFECTSINCLUDING WEAK OR BROKEN LIMBS, CROTCHES, AND DAMAGEDTRUNKS, ROOTS OR LEAVES, SUN SCALD, FRESH BARK ABRASIONS,EXCESSIVE ABRASIONS, OBJECTIONABLE DISFIGUREMENT, INSECTEGGS AND LARVAE.G. ALL PLANTS SHALL EXHIBIT NORMAL GROWTH HABITS, VIGOROUS,HEALTHY, FULL, WELL BRANCHES, WELL ROOTED, PROPORTIONATEAND SYMMETRICAL.H. ROOT SYSTEMS SHALL BE HEALTHY, DENSELY BRANCHED, FIBROUSROOT SYSTEMS, NON-POT-BOUND, FREE FROM ENCIRCLING AND/ORGIRDLING ROOTS, AND FREE FROM ANY OTHER ROOT DEFECTS(SUCH AS J-SHAPED ROOTS).I. ANY PLANT DEEMED UNACCEPTABLE BY THE LANDSCAPEARCHITECT OR OWNER'S REPRESENTATIVE SHALL BE IMMEDIATELYREMOVED FROM THE SITE AND SHALL BE REPLACED WITH ANACCEPTABLE PLANT OF LIKE TYPE AND SIZE AT THE CONTRACTOR'SOWN EXPENSE. ANY PLANTS APPEARING TO BE UNHEALTHY, EVENIF DETERMINED TO STILL BE ALIVE, SHALL NOT BE ACCEPTED. THELANDSCAPE ARCHITECT AND OWNER'S REPRESENTATIVE SHALL BETHE SOLE JUDGES AS TO THE ACCEPTABILITY OF PLANT MATERIAL.J. ALL TREES SHALL BE STANDARD IN FORM, UNLESS OTHERWISESPECIFIED. TREES WITH CENTRAL LEADERS WILL NOT BE ACCEPTEDIF LEADER IS DAMAGED OR REMOVED. PRUNE ALL DAMAGED TWIGSAFTER PLANTINGK. TREE TRUNKS TO BE STURDY, EXHIBIT HARDENED SYSTEMS ANDVIGOROUS AND FIBROUS ROOT SYSTEMS, NOT ROOT OR POTBOUND.L. TREES WITH DAMAGED OR CROOKED LEADERS, BARK ABRASIONS,SUNSCALD, DISFIGURING KNOTS, OR\INSECT DAMAGE WILL BEREJECTED.M. CALIPER MEASUREMENTS FOR STANDARD (SINGLE TRUNK) TREESSHALL BE AS FOLLOWS: SIX INCHES ABOVE THE ROOT FLARE FORTREES UP TO AND INCLUDING FOUR INCHES IN CALIPER, ANDTWELVE INCHES ABOVE THE ROOT FLARE FOR TREES EXCEEDINGFOUR INCHES IN CALIPERN. MULTI-TRUNK TREES SHALL BE MEASURED BY THEIR OVERALLHEIGHT, MEASURED FROM THE TOP OF THE ROOT BALL.O. ANY TREE OR SHRUB SHOWN TO HAVE EXCESS SOIL PLACED ONTOP OF THE ROOT BALL, SO THAT THE ROOT FLARE HAS BEENCOMPLETELY COVERED, SHALL BE REJECTED.P. SOD: PROVIDE WELL-ROOTED SOD OF THE VARIETY NOTED ON THEPLANS. SOD SHALL BE CUT FROM HEALTHY, MATURE TURF WITHSOIL THICKNESS OF 3/4" TO 1". EACH PALLET OF SOD SHALL BEACCOMPANIED BY A CERTIFICATE FROM SUPPLIER STATING THECOMPOSITION OF THE SOD.2.2 ACCESSORIES/MISCELLANEOUS MATERIALSA. MULCH - DOUBLE SHREDDED HARDWOOD MULCH, PARTIALLYDECOMPOSED BY LIVING EARTH TECHNOLOGIES OR APPROVEDSUBSTITUTE. MULCH SHOULD BE FREE OF STICKS, STONES, CLAY,GROWTH AND GERMINATION INHIBITING INGREDIENTS.B. FERTILIZER - COMMERCIAL FERTILIZER CONTAINING 10-20-10 ORSIMILAR ANALYSIS.C. SOIL PREPARATION - SHALL BE FERTILE, LOAMY SOIL. ORGANICMATTER SHALL ENCOMPASS BETWEEN 3% AND 10% OF THE TOTALDRY WEIGHT. SOIL SHALL BE FREE FROM SUBSOIL, REFUSE, ROOTS,HEAVY OR STIFF CLAY, STONES LARGER THAN 1", NOXIOUS WEEDS,STICKS, BRUSH, LITTER AND OTHER SUBSTANCES. IT SHOULD BESUITABLE FOR THE GERMINATION OF SEEDS AND THE SUPPORT OFVEGETATIVE GROWTH. THE PH VALUE SHOULD BE BETWEEN 4 AND 7. APPROXIMATE PARTICLE DISTRIBUTION FOR TOPSOILCLAY BETWEEN 15% AND 25% SILT BETWEEN 15% AND 25% SAND LESS THAN 50%GRAVEL LESS THAN 10%D. EXISTING TOPSOIL - MAY BE USED IF IT MEETS THE REQUIREMENTSFOR THE IMPORTED TOPSOIL OR IF APPROVED BY THE LANDSCAPEARCHITECT OR OWNER'S REPRESENTATIVE. TOPSOIL SHALL NOT BESTRIPPED, TRANSPORTED OR GRADED IF MOISTURE CONTENTEXCEEDS FIELD CAPACITY. TOPSOIL STOCKPILES SHALL BEPROTECTED FROM EROSION OR CONTAMINATION.E. ALL NEW TURF AREAS LOCATED ON THE FRONT, SIDES, REAR, ANDINSIDE THE FIRE LANE SHALL BE SODDED AND SHALL BE AMENDEDWITH QUALITY TOPSOIL AT A MINIMUM DEPTH OF FOUR INCHES.F. STEEL EDGING - SHALL BE 3/16” X 4” X 16” DARK GREEN LANDSCAPEEDGING.G. TREE STAKING - TREE STAKING SOLUTIONS OR APPROVEDSUBSTITUTE; REFER TO DETAILS.H. FILTER FABRIC - MIRAFI 1405 BY MIRAFI INC. OR APPROVEDSUBSTITUTE.I. SAND - UNIFORMLY GRADED, WASHED, CLEAN, BANK RUN SAND.J. DECOMPOSED GRANITE - BASE MATERIAL OF NATURAL MATERIALMIX OF GRANITE AGGREGATE NOT TO EXCEED 1/8” IN DIAMETER.K. RIVER ROCK - LOCALLY ARIZONA RIVER ROCK BETWEEN 2”-4” INDIAMETER.L. PRE-EMERGENT HERBICIDES: ANY GRANULAR, NON-STAININGPRE-EMERGENT HERBICIDE THAT IS LABELED FOR THE SPECIFICORNAMENTALS OR TURF ON WHICH IT WILL BE UTILIZED.PRE-EMERGENT HERBICIDES SHALL BE APPLIED PER THEMANUFACTURER'S LABELED RATES.PART 3 - EXECUTION3.1 PREPARATIONA. BEFORE STARTING WORK, THE LANDSCAPE CONTRACTOR SHALLVERIFY THAT THE GRADE OF ALL LANDSCAPE AREAS ARE WITHIN+/-0.1' OF FINISH GRADE. THE CONTRACTOR SHALL NOTIFY THEOWNER IMMEDIATELY SHOULD ANY DISCREPANCIES EXIST.B. SOIL TESTING:A. AFTER FINISH GRADES HAVE BEEN ESTABLISHED, CONTRACTORSHALL HAVE SOIL SAMPLES TESTED BY AN ESTABLISHED SOILTESTING LABORATORY FOR THE FOLLOWING: SOIL TEXTURALCLASS, GENERAL SOIL FERTILITY, PH, ORGANIC MATTER CONTENT,SALT (CEC), LIME, SODIUM ADSORPTION RATIO (SAR) AND BORONCONTENT. EACH SAMPLE SUBMITTED SHALL CONTAIN NO LESSTHAN ONE QUART OF SOIL.B. CONTRACTOR SHALL ALSO SUBMIT THE PROJECT'S PLANT LIST TOTHE LABORATORY ALONG WITH THE SOIL SAMPLES.C. THE SOIL REPORT PRODUCED BY THE LABORATORY SHALL CONTAINRECOMMENDATIONS FOR THE FOLLOWING (AS APPROPRIATE):GENERAL SOIL PREPARATION AND BACKFILL MIXES, PRE-PLANTFERTILIZER APPLICATIONS, AND ANY OTHER SOIL RELATED ISSUES.THE REPORT SHALL ALSO PROVIDE A FERTILIZER PROGRAM FOR THEESTABLISHMENT PERIOD AND FOR LONG-TERM MAINTENANCE.C. THE CONTRACTOR SHALL INSTALL SOIL AMENDMENTS ANDFERTILIZERS PER THE SOILS REPORT RECOMMENDATIONS. ANYCHANGE IN COST DUE TO THE SOIL REPORT RECOMMENDATIONS,EITHER INCREASE OR DECREASE, SHALL BE SUBMITTED TO THEOWNER WITH THE REPORTD. IF WEEDS ARE GROWING IN PLANTING AREAS, APPLY HERBICIDERECOMMENDED BY MANUFACTURER AND APPLIED BY AN APPROVEDLICENSED APPLICATOR. ALLOW WEEDS TO DIE, AND THEN GRUBOUT ROOTS TO A MINIMUM OF 1/2 INCH DEPTH.E. PREPARE NEW PLANTING BEDS BY TILLING EXISTING SOIL TO ADEPTH OF SIX INCHES PRIOR TO PLACING COMPOST ANDFERTILIZER. ADD SIX INCHES OF COMPOSE AND TILL INTO A DEPTHOF SIX INCHES OF THE TOPSOIL.F. POSITION TREES AND SHRUBS AS DESIGNED ON PLAN. OBTAINOWNER'S REPRESENTATIVE'S APPROVAL PRIOR TO PROCEEDING.G. ALL PLANTING AREAS SHALL RECEIVE A MINIMUM OF 2 INCH LAYEROF MULCH (SETTLED THICKNESS).3.2 EXCAVATINGA. EXCAVATE PITS FOR PLANTING. TREE PITS SHALL BE LARGE ENOUGHTO PERMIT THE HANDLING OF THE ROOT BALL WITHOUT DAMAGE TOTHE ROOTS. TREES SHALL BE PLANTED AT A DEPTH THAT WHENSETTLED, THE CROWN OF THE PLANT SHALL BEAR THE SAMERELATIONSHIP TO THE FINISH GRADE AS IT DID TO THE SOILSURFACE IN ORIGINAL PLACE OF GROWTH.B. TREE PITS PERCOLATION TEST: FILL PIT WITH WATER AND ALLOW TOSTAND FOR 24 HOURS. IF PIT DOES NOT DRAIN, THE TREE NEEDS TOBE MOVED TO ANOTHER LOCATION OR HAVE DRAINAGE ADDED.C. SHRUB AND TREE PITS SHALL BE NO LESS THAN 24” WIDER THANTHE ROOT BALL AND 6” DEEPER THAN ITS VERTICALDIMENSION. HOLES SHOULD BE ROUGH, NOT SMOOTH OR GLAZED.3.3 PLANTINGA. REMOVE NURSERY TAGS AND STAKES FROM ALL PLANTSB. REMOVE CONTAINERS WITHOUT DAMAGE TO ROOTS.C. REMOVE BOTTOM OF PLANT BOXES PRIOR TO PLACING PLANTS.REMOVE SIDES AFTER PLACEMENT AND PARTIAL BACKFILLING.D. REMOVE UPPER THIRD OF BURLAP FROM BALLED AND BURLAPPEDTREES AFTER PLACEMENT.E. PLACE PLANT UPRIGHT AND PLUMB IN CENTER OF HOLE. ORIENTPLANTS FOR BEST APPEARANCE.F. SET PLANTS WITH TOP OF ROOT BALLS FLUSH WITH ADJACENTGRADE AFTER COMPACTION. ADJUST PLANT HEIGHT IF SETTLEMENTOCCURS AFTER BACKFILLING.G. BACKFILL HOLES IMMEDIATELY AFTER PLANT IS PLACED USINGBACKFILL MIX. BACKFILL TO ONE HALF DEPTH, FILL HOLE WITHWATER AND LIGHTLY TAMP SOIL TO REMOVE VOIDS AND AIRPOCKETS.H. TRIM PLANTS TO REMOVE DEAD AND INJURED BRANCHES ONLY.BRACE PLANTS OVER 65 GALLONS IN SIZE.I. MULCH TO THE TOP OF THE ROOT BALL. DO NOT PLANT GRASS ALLTHE WAY TO TRUNK OF THE TREE. MULCH WITH AT LEAST 2” OFSPECIFIED MULCH.J. DO NOT WRAP TREES.K. DO NOT OVER PRUNE.L. BLOCKS OF SOD SHOULD BE LAID JOINT TO JOINT AFTERFERTILIZING THE GROUND FIRST. ROLL GRASS AREAS TO ACHIEVE ASMOOTH, EVEN SURFACE. THE JOINTS BETWEEN BLOCKS SHOULDBE FILLED WITH TOPSOIL AND THEN WATERED THOROUGHLY.3.4 STEEL EDGINGA. STEEL EDGING SHALL BE INSTALLED AND ALIGNED AS INDICATED ONPLANS. OWNER'S REPRESENTATIVE TO APPROVE THE STAKED ORPAINTED LOCATION OF STEEL EDGE PRIOR TO INSTALLATIONB. ALL STEEL EDGING SHALL BE FREE OF BENDS OR KINKS.C. TOP OF EDGING SHALL BE 1/2" MAXIMUM HEIGHT ABOVE FINALFINISHED GRADE.D. STAKES ARE TO BE INSTALLED ON THE PLANTING BED SIDE OF THEEDGING, NOT THE GRASS SIDE.E. STEEL EDGING SHALL NOT BE INSTALLED ALONG SIDEWALKS ORCURBS.F. EDGING SHOULD BE CUT AT A 45 DEGREE ANGLE WHERE IT MEETSSIDEWALKS OR CURBS.3.5 CLEANUPA. REMOVE CONTAINERS, TRASH, RUBBISH AND EXCESS SOILS FROMSITE AS WORK PROGRESSES.B. REPAIR RUTS, HOLES AND SCARES IN GROUND SURFACES.C. PREMISES SHALL BE KEPT NEAT AT ALL TIMES AND ORGANIZED.D. ALL PAVED AREAS SHOULD BE CLEANED AT THE END OF EACHWORK DAY.3.6 ACCEPTANCEA. ENSURE THAT WORK IS COMPLETE AND PLANT MATERIALS ARE INVIGOROUS AND HEALTHY GROWING CONDITION.B. UPON COMPLETION OF THE WORK, THE LANDSCAPE CONTRACTORSHALL PROVIDE THE SITE CLEAN, FREE OF DEBRIS AND TRASH, ANDSUITABLE FOR USE AS INTENDED. THE LANDSCAPE CONTRACTORSHALL THEN REQUEST AN INSPECTION BY THE OWNER TODETERMINE FINAL ACCEPTABILITY.C. WHEN/IF THE INSPECTED PLANTING WORK DOES NOT COMPLY WITHTHE CONTRACT DOCUMENTS, THE LANDSCAPE CONTRACTOR SHALLREPLACE AND/OR REPAIR THE REJECTED WORK TO THE OWNER'SSATISFACTION WITHIN 24 HOURS.D. THE LANDSCAPE MAINTENANCE PERIOD WILL NOT COMMENCEUNTIL THE LANDSCAPE WORK HAS BEEN RE-INSPECTED BY THEOWNER AND FOUND TO BE ACCEPTABLE. AT THAT TIME, A WRITTENNOTICE OF FINAL ACCEPTANCE WILL BE ISSUED BY THE OWNER,AND THE MAINTENANCE AND GUARANTEE PERIODS WILLCOMMENCE.END OF SECTIONNOTE:TREE STAKE SOLUTIONS OR SIMILARPRODUCTS SHOULD BE USED. INSTALLPER MANUFACTURER'S SPECIFICATIONS.TREE STAKE SOLUTIONS CONTACT:JEFF TULEY AT 903.676.6143TREE PLANTINGTREE SHALL CONFORM TOAMERICAN STANDARD FORNURSERY STOCKPIT TO BE AT LEAST 2 TIMESTHE DIA. OF ROOT BALL. TREETO BE CENTERED IN HOLEAND REST ON NATIVE SOILSHRUB PLANTINGSHRUBS OR GROUNDCOVER ASSPECIFIED ON PLANPLANTING SOIL MIX. TILL IN WITH PARTSEXISTING SOIL, EXCLUDING LARGECLODS AND ROCKS.ROOT BALL, DO NOTDISTURBUNDISTURBED SUBGRADE / NATIVE SOILWEED BARRIER FABRICLAYER OF MULCH,SETTLED THICKNESSSHOULD BE 2" MIN.CURB OR SIDEWALK,NO STEEL EDGINGALONG WALK, TYP.TOP OF MULCH SHOULD BE,AT MINIMUM, 1/2" BELOWWALK OR CURBINGREF. LANDSCAPEPLAN FOR SPACINGN.T.S.12N.T.S.1/2" MAXIMUMO.C. SPACINGO.C. SPACINGBACK OF CURBMULCH24" MIN. SETBACKFOR SHRUBS &GROUNDCOVERSALONG BACK OFCURB TO ALLOWFOR CAR OVERHANGSHRUB SPACING AND PLANTING AT B.O.C.3N.T.S.4'MIN.2.5'MIN.SPECIFIEDBED BORDER2'MIN.BACK OF CURBTREEU-BRACKET ONSAFETY STAKESAFETY STAKETREE TRUNK PLACE RINGCENTERED WITH THE TRUNKOF THE TREEROOTBALLNAIL STAKESMULCH PER SPECIFICATIONSLAWNSHRUBS AND GROUNDCOVERREFER TO PLANS FOR PLANT TYPESPREPARED SOIL MIXPER SPECIFICATIONS3/16" X 4" X 16" STEEL EDGING WITHSTAKESNOTE: NO STEEL EDGINGTO BE INSTALLED ALONGSIDEWALKS1/2" MAXIMUMUNDISTURBED EARTHROOTBALL: REMOVE BURLAP ANDROP FROM TOP 13 OF THE BALL.PLACE TOP OF ROOT BALL MIN. 1" -MAX. 2" ABOVE GRADEU-BRACKET ON SAFETY STAKESAFETY STAKE4" MULCH OVER WEED BLOCKCREATING A 4" DEEP SAUCERNAIL STAKE INSTALLED FIRMLYINTO GROUND FLUSH WITH "U"BRACKET, DO NOT INSTALLINTO ROOTBALLPLANTING HOLESTEEL EDGING DETAIL4N.T.S.FINISH GRADEBACK FILL / PLANTING SOIL MIX. TILL INWITH PARTS EXISTING SOIL, EXCLUDINGLARGE CLODS AND ROCKS.DECOMPOSED GRANITE / RIVER ROCK5N.T.S.DECOMPOSED GRANITE AND/ORRIVER ROCK TO BECOMPACTED TO A 3" DEPTHPLANTING AREA, REFERENCELANDSCAPE PLANDECOMPOSED GRANITE /RIVER ROCKENSURE PROPER DRAINAGESTEEL EDGINGFILTER FABRIC, WRAPUP AT EDGING, TYP.COMPACTED SUBGRADEPRELIMINARYNOT FOR CONSTRUCTION FIRST FLOOR 13 GUEST ROOMSSECOND FLOOR 29 GUEST ROOMSTHIRD FLOOR 29 GUEST ROOMSFOURTH FLOOR 29 GUEST ROOMSFIFTH FLOOR 29 GUEST ROOMSTOTAL GUEST ROOMS = 12954X21FIRST FLOOR PLAN42X211234567891013151720121416181923467891037WDWC42X2115F&BSTOR138113LOBBY109TOILET128EMPL.ROOM129BREAKDRYERS127LAUNDRY125LINEN126CORRIDOR137MECHELECTRICELECTRIC123MEETINGROOMJAN120WOMEN121MEN122117CENTER118BUSINESSSTOR.119CARTVESTIBULE100FRONT DESKMECH112SHOP114SUNDRIESGIFT /WORK AREATELECOM1111,258 S.F.COMP./CORRIDOR115SALES107G.M.108FOOD PREP104PANTRY103LODGE102LOBBY101CORRIDOR115SPRINKLER140STORMEETINGWATER HEATERS106116ELECT105BOARD ROOMICEENGINEERING136K STUDIO112K STUDIO110K STUDIO108K STUDIO106K STUDIO104K STUDIO109K STUDIO107K STUDIO105ELEVATORMECH130131CORR.137COATS116AVESTIBULE135VESTIBULE139VESTIBULE141FITNESS 770 S.F.133A/CSTAIR #2STORAGESTAIR #1OFFICEK STUDIO103ICE11K STUDIO102K STUDIO101K STUDIO111K STUDIO113ACAC461 S.F.11SCALE: 1/8" = 1'-0"ELEV. #1ELEV. #2AC42X2142X211,206 SFOUTDOOR PATIO316'-3"102'-6"HOTEL DESIGN FEATURES / AMENITIES:A-301REVISIONSBYDateSheetJob17078HOTEL PROJECT9-7-2018Di idend Bl d. & Point W. Bl d. (Ne r 635)Co ell, Te PRELIMINARYPRELIMINARY - FOR REVIEW ONLYHiltonSUITESHOMEWOODSUITE E817/538-92581029 LONG PRAIRIE ROADRSS-ARCHITECTS.COMFLOWER MOUND, TX 75022&YIJCJU& 2ND thru 5TH FLOOR PLANCORRIDORELEV. #1ELEV. #2CORRIDORK STUDIO225K STUDIO223K STUDIO221K STUDIO219DQ SUITE206K SUITE203K STUDIO217K STUDIO215K STUDIO213LODGE BELOWDQ STUDIO209DQ STUDIO201STORAGEICE200202203204LOBBY205ELEVATORELECTGUEST LAUNDRYSTAIR #1STORAGEK STUDIO227K STUDIO226DQ STUDIO207DQ STUDIO202STAIR #2K STUDIO224K STUDIO222K STUDIO220DQ STUDIO205DQ SUITE204206K SUITE208201202200DQ STUDIO211K STUDIO228K STUDIO229K STUDIO216K STUDIO218K STUDIO214K STUDIO212LINENK STUDIO210SCALE: 1/8" = 1'-0"12345678910131517201214161819234678910151111A-302REVISIONSBYDateSheetJob17078HOTEL PROJECT8-16-2018Di idend Bl d. & Point W. Bl d. (Ne r 635)Co ell, Te PRELIMINARYPRELIMINARY - FOR REVIEW ONLYHiltonSUITESHOMEWOODSUITE E817/538-92581029 LONG PRAIRIE ROADRSS-ARCHITECTS.COMFLOWER MOUND, TX 75022&YIJCJU' ϱϭϬϰϬϬϴϭϯƌϯD^tͬDtDϴͬϮϬͬϭϴZϭ<DĐϴͬϮϬͬϭϴ͗ĂĚĚĞĂƐƚĞůĞǀĂƚŝŽŶZϮͲ>ͲϬϵͬϭϬͬϭϴ͗ĂĚĚĞĚƐĨ͘ĐĂůĐ͘ƚŽĂůůƐŝŐŶƐ͖ƌĞǀŝƐĞĚ͟͞ƚŽďƌŝĐŬďĂƐĞƌĞǀŝƐĞĚĨĂĐĞƐƚŽĨĐŽ͛ƐĂŶĚĂĚĚĞĚŐƌŽƵŶĚůŝŐŚƚĨŝǆƚƵƌĞƐ͘Zϯ^ϵͬϭϴƐƵƌƌŽƵŶĚ,KDtKK^h/d^/s/EΘWK/Edt^dKWW>>͕dy^&ZKEd;^Khd,Ϳ>sd/KEZ/',d;t^dͿ>sd/KE^>͗ϭͬϯϮΗсϭΖͲϬΗ^>͗ϭͬϯϮΗсϭΖͲϬΗϭϭΖͲϱЬΗY YϭϱΖͲϯΗY YϮϲΖͲϲΗцϯϭϲΖͲϯΗϮϰΖͲϰΗцϵϲΖͲϭϬΗϴΖͲϮзΗ ĞƋĞƋϯΖͲϭϬвΗϳϯΖͲϵΗϭϬΖͲϯΗцϱΖͲϬΗ/E^d;zKd,Z^ͿϳϯΖͲϵΗϭϯΖͲϭϬЪΗцϭϬΖͲϭϭдΗĞƋĞƋϳΖͲϬΗ/E^d;zKd,Z^ͿϲΖͲϭϭЬΗ>&d;^dͿ>sd/KE^>͗ϭͬϯϮΗсϭΖͲϬΗϳϯΖͲϵΗϵϲΖͲϭϬΗϭϱΖͲϯΗY YϮϰΖͲϰΗцϭϯΖͲϭϬЪΗцϭϬΖͲϭϭдΗĞƋĞƋ&YIJCJU(PG ϱϮϬϰϬϬϴϭϯƌϯD^tͬDtDϴͬϮϬͬϭϴZϭ<DĐϴͬϮϬͬϭϴ͗ĂĚĚĞĂƐƚĞůĞǀĂƚŝŽŶZϮͲ>ͲϬϵͬϭϬͬϭϴ͗ĂĚĚĞĚƐĨ͘ĐĂůĐ͘ƚŽĂůůƐŝŐŶƐ͖ƌĞǀŝƐĞĚ͟͞ƚŽďƌŝĐŬďĂƐĞƌĞǀŝƐĞĚĨĂĐĞƐƚŽĨĐŽ͛ƐĂŶĚĂĚĚĞĚŐƌŽƵŶĚůŝŐŚƚĨŝǆƚƵƌĞƐ͘Zϯ^ϵͬϭϴƐƵƌƌŽƵŶĚ,KDtKK^h/d^/s/EΘWK/Edt^dKWW>>͕dy^>ddZ^ͬ>K'KͲ>/',dK>KZh/>/E'>ddZ^ͬ>K'KͲ>/',dK>KZh/>/E'>/',dK>KZh/>/E'Ͳd>zͬt,/dE/',d>/',dK>KZh/>/E'Ͳd>zͬt,/dE/',dϭΖͲϯΗ/ΗϭΖͲϴΗ/ΗϭΖͲϯΗ,ΗϭΖͲϴΗ,ΗϮΖͲϬЬΗϮΖͲϴдΗϳΗϵЬΗϳЬΗϵвΗϱвΗϳзΗϭиΗϮЪΗϰЪΗϲΗϭΖͲϲΗϮΖͲϬΗϭϭΖͲϱЬΗ;ϯ͕ϰϴϲ͘ϮŵŵͿϭϱΖͲϯΗ;ϰ͕ϲϰϴ͘ϯŵŵͿϱΖͲϴиΗ͞^h/d^͟ϳΖͲϳвΗ͞^h/d^͟ϰΖͲϳвΗh<ϲΖͲϮЬΗh<ϴΖͲϮзΗ;Ϯ͕ϱϬϯ͘ϲŵŵͿϭϬΖͲϭϭдΗ;ϯ͕ϯϯϴ͘ϮŵŵͿϱΖͲϱΗϳΖͲϮзΗϲΖͲϮΗϴΖͲϮвΗ^>͗ϯͬϴΗсϭΖͲϬΗ^>͗ϯͬϴΗсϭΖͲϬΗKE΀ϭ΁^dZYh/ZͲDEh&dhZΘ/E^d>>dtK΀Ϯ΁^d^ZYh/ZͲDEh&dhZΘ/E^d>>ϵϯ͘ϵϴ^Y&dϭϲϲ͘ϵϰ^Y&d&YIJCJU(PG ϱϯϬϰϬϬϴϭϯƌϯD^tͬDtDϴͬϮϬͬϭϴZϭ<DĐϴͬϮϬͬϭϴ͗ĂĚĚĞĂƐƚĞůĞǀĂƚŝŽŶZϮͲ>ͲϬϵͬϭϬͬϭϴ͗ĂĚĚĞĚƐĨ͘ĐĂůĐ͘ƚŽĂůůƐŝŐŶƐ͖ƌĞǀŝƐĞĚ͟͞ƚŽďƌŝĐŬďĂƐĞƌĞǀŝƐĞĚĨĂĐĞƐƚŽĨĐŽ͛ƐĂŶĚĂĚĚĞĚŐƌŽƵŶĚůŝŐŚƚĨŝǆƚƵƌĞƐ͘Zϯ^ϵͬϭϴƐƵƌƌŽƵŶĚ,KDtKK^h/d^/s/EΘWK/Edt^dKWW>>͕dy^ϴΗ͞/͟ ϴΗ͞,͟ϮΖͲϱЪΗϯΖͲϬвΗϮΖͲϬЪΗϭΖͲϭϭЬΗ ϭΖͲϭϭЬΗϱЪΗ͞,͟ϱΗϯиΗϯЬΗϭΖͲϬиΗ&K>ddZd/>^>͗ϯͬϰΖΖсϭΖͲϬΖΖKE΀ϭ΁^dZYh/ZͲDEh&dhZΘ/E^d>>ϲΖͲϭЬΗ;ϭ͕ϱϴϵ͘ϰŵŵͿЪΗϯΖͲϭϬзΗ;ϭ͕ϭϴϱ͘ϭŵŵͿϮϯ͘ϳϭ^Y&d&YIJCJU(PG ϱϰϬϰϬϬϴϭϯƌϯD^tͬDtDϴͬϮϬͬϭϴZϭ<DĐϴͬϮϬͬϭϴ͗ĂĚĚĞĂƐƚĞůĞǀĂƚŝŽŶZϮͲ>ͲϬϵͬϭϬͬϭϴ͗ĂĚĚĞĚƐĨ͘ĐĂůĐ͘ƚŽĂůůƐŝŐŶƐ͖ƌĞǀŝƐĞĚ͟͞ƚŽďƌŝĐŬďĂƐĞƌĞǀŝƐĞĚĨĂĐĞƐƚŽĨĐŽ͛ƐĂŶĚĂĚĚĞĚŐƌŽƵŶĚůŝŐŚƚĨŝǆƚƵƌĞƐ͘Zϯ^ϵͬϭϴƐƵƌƌŽƵŶĚ,KDtKK^h/d^/s/EΘWK/Edt^dKWW>>͕dy^ͬ&DKEhDEd^/'E;,^ͲDͲϭϲͿ^>͗ϭΖΖсϭΖͲϬΗϮΖͲϮЬΗ;ϲϲϲ͘ϴŵŵͿϳΖͲϮΗ;Ϯϭϴϰ͘ϭŵŵͿKsZ>>,/',dϰΖͲϭΗ;ϭϮϰϰ͘ϲŵŵͿϭϭЪΗ;ϮϵϮ͘ϭŵŵͿϭЪΗ;ϯϴ͘ϭŵŵͿϰΖͲϭΗ;ϭϮϰϰ͘ϲŵŵͿϯΖͲϰиΗ;ϭϬϯϴ͘ϮŵŵͿϭΖͲϬΗ;ϯϬϰ͘ϴŵŵͿϮΗ;ϱϬ͘ϴŵŵͿEs/tKE΀ϭ΁ZYh/ZͲDEh&dhZΘ/E^d>>ϰϯ͘ϱϵ^Y&dϮΗ ϮΗϲΖͲϭΗ;ϭ͕ϴϱϰŵŵͿϲΖͲϭΗ;ϭϴϱϰŵŵͿ&YIJCJU(PG ϱϱϬϰϬϬϴϭϯƌϯD^tͬDtDϴͬϮϬͬϭϴZϭ<DĐϴͬϮϬͬϭϴ͗ĂĚĚĞĂƐƚĞůĞǀĂƚŝŽŶZϮͲ>ͲϬϵͬϭϬͬϭϴ͗ĂĚĚĞĚƐĨ͘ĐĂůĐ͘ƚŽĂůůƐŝŐŶƐ͖ƌĞǀŝƐĞĚ͟͞ƚŽďƌŝĐŬďĂƐĞƌĞǀŝƐĞĚĨĂĐĞƐƚŽĨĐŽ͛ƐĂŶĚĂĚĚĞĚŐƌŽƵŶĚůŝŐŚƚĨŝǆƚƵƌĞƐ͘Zϯ^ϵͬϭϴƐƵƌƌŽƵŶĚ,KDtKK^h/d^/s/EΘWK/Edt^dKWW>>͕dy^^>͗ϭΗсϴϬΖͲϬΗ^/dW>E&YIJCJU(PG ϱϲϬϰϬϬϴϭϯƌϯD^tͬDtDϴͬϮϬͬϭϴZϭ<DĐϴͬϮϬͬϭϴ͗ĂĚĚĞĂƐƚĞůĞǀĂƚŝŽŶZϮͲ>ͲϬϵͬϭϬͬϭϴ͗ĂĚĚĞĚƐĨ͘ĐĂůĐ͘ƚŽĂůůƐŝŐŶƐ͖ƌĞǀŝƐĞĚ͟͞ƚŽďƌŝĐŬďĂƐĞƌĞǀŝƐĞĚĨĂĐĞƐƚŽĨĐŽ͛ƐĂŶĚĂĚĚĞĚŐƌŽƵŶĚůŝŐŚƚĨŝǆƚƵƌĞƐ͘Zϯ^ϵͬϭϴƐƵƌƌŽƵŶĚ,KDtKK^h/d^/s/EΘWK/Edt^dKWW>>͕dy^>ddZ^ͬ>K'KͲ>/',dK>KZh/>/E'>ddZ^ͬ>K'KͲ>/',dK>KZh/>/E'>/',dK>KZh/>/E'Ͳd>zͬt,/dE/',d>/',dK>KZh/>/E'Ͳd>zͬt,/dE/',dͲϱΗ;ϭϮϳŵŵͿW,EE>>ddZ^ǁͬZDKdWKtZ^hWW>/^Ͳ͘ϬϰϬΗ;ϭŵŵͿd,/<>hD͘ZdhZE^ǁͬ͘ϬϱϬΗ;ϭ͘ϯŵŵͿd,/<>hD͘Ͳhd<^ͲZdhZE^W/EddKDd,WD^ϯϮϯĐd>Ͳ͘ϭϳϳΗ;ϰ͘ϱŵŵͿd,/<zZK^'tZdϯϬt,/d&^ǁͬϭƐƚ^hZ&ϯD;KZWWZKsYh/s͘ͿsEϭϮϲϲϭd>h>ͲK>KZs/Ez>ͲϭΗ;Ϯϱ͘ϰŵŵͿ'K>:t>/d;KZWWZKsYh/s͘ͿZd/EZdKh^WZDEh&dhZZΖ^ZKDDEd/KE^Ͳ͘ϬϴϬΗ;ϮŵŵͿd,/<>hD͘ZͲKͬ^ͲdW^h>&Θ͘ϬϲϯΗ;ϭ͘ϲŵŵͿd,/<>hD͘ZdhZE^W/EddKDd,WD^ϯϮϯĐd>ͲZͲKͬ^ͲdKWz<hWǁͬ͘ϭϮϱΗ;ϯ͘ϮŵŵͿd,/<zZK^'tZdϯϭt,/dZz>/Ͳ/>>hD/Edǁͬt,/d>ΖƐdK/E^d>>WZDEh&dhZZΖ^ZKDDEd/KE^Ͳ>WKtZ^hWW>/^;ZDKd,/Et>>ͿW^h>^d/KEW^h>^d/KE>ddZ^d/KE>ddZ^d/KEϭΖͲϯΗ/ΗϭΖͲϴΗ/ΗϭΖͲϯΗ,ΗϭΖͲϴΗ,ΗϮΖͲϬЬΗϮΖͲϴдΗϳΗϵЬΗϳЬΗϵвΗϱвΗϳзΗϭиΗϮЪΗϰЪΗϲΗϭΖͲϲΗϮΖͲϬΗϭϭΖͲϱЬΗ;ϯ͕ϰϴϲ͘ϮŵŵͿϭϱΖͲϯΗ;ϰ͕ϲϰϴ͘ϯŵŵͿϱΖͲϴиΗ͞^h/d^͟ϳΖͲϳвΗ͞^h/d^͟ϰΖͲϳвΗh<ϲΖͲϮЬΗh<ϴΖͲϮзΗ;Ϯ͕ϱϬϯ͘ϲŵŵͿϭϬΖͲϭϭдΗ;ϯ͕ϯϯϴ͘ϮŵŵͿϱΖͲϱΗϳΖͲϮзΗϲΖͲϮΗϴΖͲϮвΗ>>/>>hD/Ed^/'E'ZYh/Zd,>/EdΖ^>dZ//EdK&hZE/^,Θ/E^d>>KDW>dW,KdK>>EͬKZd/D>K<dK>>Kt^/'E^dKKWZdd^/'Ed/EdZs>^͘,KtsZ͕^/'E^,>>EsZKWZdKEϮϰͬϳ^/^͘^>͗ϯͬϴΗсϭΖͲϬΗ^>͗ϯͬϴΗсϭΖͲϬΗKE΀ϭ΁^dZYh/ZͲDEh&dhZΘ/E^d>>dtK΀Ϯ΁^d^ZYh/ZͲDEh&dhZΘ/E^d>>ϵϯ͘ϵϴ^Y&dϭϲϲ͘ϵϰ^Y&d&YIJCJU(PG ϱϳϬϰϬϬϴϭϯƌϯD^tͬDtDϴͬϮϬͬϭϴZϭ<DĐϴͬϮϬͬϭϴ͗ĂĚĚĞĂƐƚĞůĞǀĂƚŝŽŶZϮͲ>ͲϬϵͬϭϬͬϭϴ͗ĂĚĚĞĚƐĨ͘ĐĂůĐ͘ƚŽĂůůƐŝŐŶƐ͖ƌĞǀŝƐĞĚ͟͞ƚŽďƌŝĐŬďĂƐĞƌĞǀŝƐĞĚĨĂĐĞƐƚŽĨĐŽ͛ƐĂŶĚĂĚĚĞĚŐƌŽƵŶĚůŝŐŚƚĨŝǆƚƵƌĞƐ͘Zϯ^ϵͬϭϴƐƵƌƌŽƵŶĚ,KDtKK^h/d^/s/EΘWK/Edt^dKWW>>͕dy^ϱΗ;ϭϮϳŵŵͿ͘ϬϰϬΗ;ϭŵŵͿd,/<>hD͘ZdhZEϭΗ;Ϯϱ͘ϰŵŵͿ:t>/dZd/EZ;KZWWZKsYh/s͘dKh^WZDEh&dhZZΖ^ZKDDEd/KE^Ϳ͘ϭϳϳΗ;ϰ͘ϱŵŵͿd,/<zZK^'&^Ͳ^WZs/Kh^^,d&KZK>KZdZdDEd͘ϬϱϬΗ;ϭ͘ϯŵŵͿd,/<>hD͘Ͳhd<^/>>hD/Edǁͬt,/d>͛^Ͳ/E^d>>>͛ƐWZDEh&dhZZΖ^ZKDDEd/KE^tW,K>^/E>KtWK/Ed^K&>ddZ^;ϮͿD/E͘W/Ed>ddZ/EdZ/KZǁͬ^dZZ/d>͘͘W͘ ;ZDKdWKtZ^hWW>zͿW^h>^d/KE ͘ϬϲϯΗ;ϭ͘ϲŵŵͿd,/<>hD͘t>ZdhZE͘ϬϴϬΗ;ϮŵŵͿd,<͘>hD͘ZͲKͬ^Ͳd&t>dKZdhZE^͘ϬϴϬΗ;ϮŵŵͿd,/<>hD͘Ͳhd<ǁͬ͘ϬϲϯΗ;ϭ͘ϲŵŵͿd,/<>hD͘t>&>E'Ͳ&>E'/^ϭЪΗ;ϯϴ͘ϭŵŵͿt/ZͲKͬ^ͲdKWzKE&<ǁͬ͘ϭϮϱΗ;ϯ͘ϮŵŵͿd,/<tZdϯϬzZK^'Ͳ^WZs/Kh^^,d&KZd/>^tW,K>^/E>KtWK/Ed^K&>K'KͲ;ϮͿD/E͘h͘>͘>>^ZYh/Z/E^d>>/EKZEt/d,E͘͘h͘>͘>>^ZYh/Z/E^d>>/EKZEt/d,E͘͘dd,dKt>>ǁͬϭͬϰΗ;ϲ͘ϰŵŵͿ/͘EKEͲKZZK^/sDd'͘,ZtZ^ZYh/ZWZt>>KE^dZhd/KEϱΗ;ϭϮϳŵŵͿ/>>hD/Edǁͬt,/d>͛ƐͲ/E^d>>>͛ƐWZDEh&dhZZΖ^ZKDDEd/KE^͘>>/>>hD/Ed^/'E'ZYh/Zd,>/EdΖ^>dZ//EdK&hZE/^,Θ/E^d>>KDW>dW,KdK>>EͬKZd/D>K<dK>>Kt^/'E^dKKWZdd^/'Ed/EdZs>^͘,KtsZ͕^/'E^,>>EsZKWZdKEϮϰͬϳ^/^͘;ZDKdWKtZ^hWW>zͿ^KEZzd,ZKh',W/'t>>h^dZ^;KZ^>d/',dͿKEh/dΘKEEdKZ^dKZDKdWKtZ^hWW>/^>Kd,/E&^//E'>sE/WKtZ^hWW>zKy^ͲdKDd;EͿWZ>K>K^^KEZzd,ZKh',W/'t>>h^dZ^;KZ^>d/',dͿKEh/dΘKEEdKZ^dKZDKdWKtZ^hWW>/^>Kd,/E&^//E'>sE/WKtZ^hWW>zKy^ͲdKDd;EͿWZ>K>K^>K'KΘ>ddZ^d/KE&YIJCJU(PG ϱϴϬϰϬϬϴϭϯƌϯD^tͬDtDϴͬϮϬͬϭϴZϭ<DĐϴͬϮϬͬϭϴ͗ĂĚĚĞĂƐƚĞůĞǀĂƚŝŽŶZϮͲ>ͲϬϵͬϭϬͬϭϴ͗ĂĚĚĞĚƐĨ͘ĐĂůĐ͘ƚŽĂůůƐŝŐŶƐ͖ƌĞǀŝƐĞĚ͟͞ƚŽďƌŝĐŬďĂƐĞƌĞǀŝƐĞĚĨĂĐĞƐƚŽĨĐŽ͛ƐĂŶĚĂĚĚĞĚŐƌŽƵŶĚůŝŐŚƚĨŝǆƚƵƌĞƐ͘Zϯ^ϵͬϭϴƐƵƌƌŽƵŶĚ,KDtKK^h/d^/s/EΘWK/Edt^dKWW>>͕dy^ϴΗ͞/͟ ϴΗ͞,͟ϮΖͲϱЪΗϯΖͲϬвΗϲΖͲϭЬΗ;ϭ͕ϱϴϵ͘ϰŵŵͿϮΖͲϬЪΗϭΖͲϭϭЬΗ ϭΖͲϭϭЬΗЪΗϱЪΗ͞,͟ϱΗϯиΗϯЬΗϭΖͲϬиΗϯΖͲϭϬзΗ;ϭ͕ϭϴϱ͘ϭŵŵͿ&K>ddZd/>^>͗ϯͬϰΖΖсϭΖͲϬΖΖ&>dhdͲKhdZ<Ky//ZKE>ddZ^&>dhdͲKhdZ<Ky//ZKEΖΖh<ΖΖ>K'K&>dhdͲKhdZ<Ky//ZKE>ddZ^&>dhdͲKhdZ<Ky//ZKEΖΖZh>>/EΖΖKE΀ϭ΁^dZYh/ZͲDEh&dhZΘ/E^d>>͗ϯͬϴΗ;ϵ͘ϱŵŵͿd,/<&>dhdͲKhdZ<Ky//ZKE'ZW,/^Ͳ&>h^,ͲDKhEdEdZ/E/E^dt>>Zǁͬ>>Ͳd,Z^dh^Θ^/>/KE,^/s^ZY͛Ϯϯ͘ϳϭ^Y&d&YIJCJU(PG ϱϵϬϰϬϬϴϭϯƌϯD^tͬDtDϴͬϮϬͬϭϴZϭ<DĐϴͬϮϬͬϭϴ͗ĂĚĚĞĂƐƚĞůĞǀĂƚŝŽŶZϮͲ>ͲϬϵͬϭϬͬϭϴ͗ĂĚĚĞĚƐĨ͘ĐĂůĐ͘ƚŽĂůůƐŝŐŶƐ͖ƌĞǀŝƐĞĚ͟͞ƚŽďƌŝĐŬďĂƐĞƌĞǀŝƐĞĚĨĂĐĞƐƚŽĨĐŽ͛ƐĂŶĚĂĚĚĞĚŐƌŽƵŶĚůŝŐŚƚĨŝǆƚƵƌĞƐ͘Zϯ^ϵͬϭϴƐƵƌƌŽƵŶĚ,KDtKK^h/d^/s/EΘWK/Edt^dKWW>>͕dy^Es/t dtK΀Ϯ΁&Z/d^ͬ&>hDWEWE>ǁͬϮΖΖZdhZE^ͬWE>&,^ϮΖΖKhd^/KZZ<'ZKhEW/EddKDd,WD^ϯϮϯĐͲdKDd,WEdKEtZDZĐͲ/E^/<'ZKhEW/EddKDd,ϯϲϯϬͲϲϵϰϵd>'ZEs/Ez>Z^^͘ϬϲϯΗ;ϭ͘ϲŵŵͿd,/<>hD͘Zs>ͲW/EddKDd,WD^ϰϭϵĐZ<'Zz;^d/E&/E/^,ͿZ/<^KsZͬDK^//Ed,/EZ/<Ͳ'͘͘dKWZKs/DdZ/>E/E^d>>d/KEK&Z/<^ͬ&DKEhDEd/>>hD/EdǁͬydZE>'ZKhEDKhEd>/',d&/ydhZ^ͲK^>^/'E>/',dZEKd͗&/ydhZ^EhEZ'ZKhE>dZ/>^Zs/dKWZKs/E/E^d>>z'͛͘͘Ɛ>dZ//Ed^ϮΗǆϮΗǆ͘ϭϴϳΗ;ϱϬ͘ϴŵŵǆϱϬ͘ϴŵŵǆϰ͘ϴŵŵͿ^d>^hWWKZdϵΗ;ϮϮϴ͘ϲŵŵͿ/͘ǆϯΖͲϬΗ;ϵϭϰ͘ϰŵŵͿWKEZdW/Z&KhEd/KEͲ&KhEd/KE^dϮΗ;ϱϬ͘ϴŵŵͿ>Kt'Z>>/>>hD/Ed^/'E'ZYh/Zd,>/EdΖ^>dZ//EdK&hZE/^,Θ/E^d>>KDW>dW,KdK>>ΘͬKZd/D>K<dK>>Kt^/'E^dKKWZdd^/'Ed/EdZs>^Ͳ,KtsZ͕^/'E^,>>EsZKWZdKEϮϰͬϳ^/^ϭΖͲϬΗ;ϯϬϰ͘ϴŵŵͿϮΗ ϮΗϮΖͲϮЬΗ;ϲϲϲ͘ϴŵŵͿϳΖͲϮΗ;Ϯϭϴϰ͘ϭŵŵͿKsZ>>,/',dϰΖͲϭΗ;ϭϮϰϰ͘ϲŵŵͿϭϭЪΗ;ϮϵϮ͘ϭŵŵͿϭЪΗ;ϯϴ͘ϭŵŵͿϰΖͲϭΗ;ϭϮϰϰ͘ϲŵŵͿϯΖͲϰиΗ;ϭϬϯϴ͘ϮŵŵͿϮΗ;ϱϬ͘ϴŵŵͿͬ&DKEhDEd^/'E;,^ͲDͲϭϲͿ^>͗ϭΖΖсϭΖͲϬΗKE΀ϭ΁ZYh/ZͲDEh&dhZΘ/E^d>>ϰϯ͘ϱϵ^Y&dϲΖͲϭΗ;ϭϴϱϰŵŵͿϲΖͲϭΗ;ϭϴϱϰŵŵͿд͟d,/<>ZZz>/&K'ZW,/^EKWzΖΖh<ΖΖ>K'KW/EddKDd,ϯDϯϲϯϬͲϭϯϭDd>>/'K>s/Ez>KWzΘZh>>/E^W/Edt,/d^dKEsEZ^hZZKhEKZKEK/Eh^dZ/>>'Η^,>'ZzΗzKd,Z^&YIJCJU(PG !"#$% !"& !" #"$ " " "!'"'"! ()( % " &$" *$ "' $ +',-./ $0 $"*$ &0+''$$' "1$ " #"2'"$0% "$ 34) '3 '"$0+ " 2"$0 '5'"!$0'$6"!$ '!""2 2%"$ " '"$" " &0+''$$' " 6% 3 &0+ 0+''$3" #"23'+$' "/0$ / $0 $"/7 38$$ 3&2 /'!"3 '$ "$2$' " "$2$3 &$(" '"$" )"* "$ '$+ ) ,*+ &$" # #" " &$"* -% ! " (9('$ "2' ,*+ '$ "' $ +',-./ $0 $"*$ &0+''$$' "1$ " #"2'"$0% "$ 34) '3 '"$0+ " 2" $0 '5'"!$0'$6"!$ '!""2 2%"$ /%% $ $ 03'2'%2$ 3$0' !"'$%'4) '3 '"$0+ " 2 #$"%" 0+'2* :$%"$2 %%" 3$0'2 "$2$ '$0" #"2 . $" " .+"" 1 MEMORANDUM To: Mayor and City Council From: Kent Collins, P.E., Director of Public Works Date: November 13, 2018 Reference: Award of Bid No. Q-1019-01 Southwestern Elevated Storage Tank Rehabilitation 2030: Sustainable City Government, Goal 3 Excellent and Well-maintained City Infrastructure and Facilities General Information: x Dunham Engineering provided inspection services in July 2014 x Water Tower #1 was constructed in 1986 and is in fair condition x Discovered minor corrosion, less than 5%, recommended a new protective coating x Replace interior wet area coating with a three-coat zinc/epoxy/epoxy coating system (15-20 years) $450,000 x Replace exterior coating with a four-coat zinc/epoxy/polyurethane/fluoropolymer coating system (15-20 years) $600,000 x Structural repairs including the roof hatch = $50,000 x Received bids from 9 vendors, low bid was $1,021,679, high bid was $1,381,550 Introduction: This agenda item is being presented for Award of Bid No. Q-1019-01 Southwestern Elevated Storage Tank Rehabilitation project to Tank Pro, Inc. in the amount of $1,021,679 and approval of an incentive amount up to an additional $30,000 for early completion for a total award of $1,051,679. Analysis: Water Tower #1, located at Southwestern Blvd. and Coppell Road, was constructed in 1986, and is a 1.5 million gallon all steel elevated storage tank. The tank consists of a 40-feet-tall bowl structure that sits on a 120-feet-tall pedestal, for a total height of 160 feet. In July 2014 Dunham Engineering conducted an evaluation and inspection of both of Coppell’s elevated water towers. Those evaluations resulted in recommended rehabilitation and painting of both towers, with varying levels of rehabilitation, and a longer time frame for Tower #2. Tower #1 2 noted corrosion of the steel tower at a rate of approximately 5%, and a recommended time frame for action of 2 years. It was also noted that the roof hatch does not meet current requirements of the Texas Commission on Environmental Quality, which is the state agency that regulates public water systems. On December 9th, 2014 the City Council approved a Design contract with Dunham Engineering for the design and preparation of Bid documents to perform the needed rehabilitation. The contract with Dunham includes inspection and contract administration for the rehabilitation of this tower. On October 16, 2018 the city received and opened 9 sealed bids for this rehabilitation. The bids ranged from a low of $1,021,679 to a high of $1,381,550. The low bid was submitted by Tank Pro, Inc. Dunham Engineering is familiar with the work history of this firm, has reviewed their references, and has provided a recommendation to award the contract to Tank Pro, Inc. This project will require taking the water tower out of service for a period of up to five months. Due to high water use during the summer months this work has been scheduled to begin in late December to early January. This contract includes an incentive provision of $500 per day for early completion with a maximum incentive of $30,000. Legal Review: A standard form agreement is being utilized on this project and has been reviewed by the City Attorney previously. Fiscal Impact: The fiscal impact of this Agenda item is $1,051,679, as provided for in the bond proceeds. Recommendation: The Public Works Department recommends approval of this contract with Tank Pro, Inc. Southwestern Elevated StorageTank Rehabilitation ProjectIMF FY 2018-2019Cre ted in CIVIL3D1 INCH = 1 MILE0S: CAD In De i n MISC EXHIBITS d EXHIBITS 2015.d TOWER 1 REHABCre ted on: 22 M rch 2018 Scott L tt 1/21/2 1 1 INCH = FT.010010050Southwestern Elevated StorageTank Rehabilitation ProjectIMF FY 2018-2019Cre ted in CIVIL3DS: CAD In De i n MISC EXHIBITS d EXHIBITS 2015.d TOWER 1 REHABCre ted on: 22 M rch 2018 Scott L tt 2/2 www.DunhamEngineering.com Texas Registration Number: F- 002253 12815 FM 2154, Suite 150 College Station, Texas 77845 Contractor Base Bid Alt 1 Tang. Personal Prop. Classic Protective Coatings 1,187,975$ 260,500$ 1,448,475$ CFG Ind 1,205,150$ 174,000$ 150,000$ MK Painting, Inc. 961,400$ 175,000$ 380,000$ Cherokee Painting Gulf States Protective Coatings, Inc 1,200,550$ 181,000$ 375,000$ Utility Service/Suez 1,045,500$ 206,700$ 1,251,900$ A&M Construction & Utilities, Inc. 961,500$ 233,000$ 461,500$ Tank Pro, Inc. 891,429$ 130,250$ 202,300$ TMI Coatings, Inc Maguire Iron 1,056,025$ 218,000$ $507,610 (Including Alternate) NG Painting, L.P. 1,150,000$ 166,600$ -$ No Bid No Bid Southwestern EST Bid Tabulation Sheet The City of Coppell Bids opened October 16, 2018 @ 2:00 p.m. CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 CITY OF COPPELL, TEXAS STANDARD FIXED PRICE AGREEMENT FOR THE CONSTRUCTION OF BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 2 City of Coppell, Texas This Agreement is made by and between the City of Coppell, Texas, a home-rule municipality (hereinafter referred to as the "Owner") and __________________________________, (hereinafter referred to as the "Contractor") for construction of __________________________________, (hereinafter referred to as the "Project"), the Owner and the Contractor hereby agreeing as follows: ARTICLE I THE CONTRACT AND THE CONTRACT DOCUMENTS 1.1 THE CONTRACT 1.1.1 The Contract between the Owner and the Contractor, of which this Agreement is a part, consists of the Contract Documents. It shall be effective on the date this Agreement is executed by the last party to execute it. 1.2. THE CONTRACT DOCUMENTS 1.2.1 The Contract Documents consist of this Agreement, the Invitation to Bid, Requirements and Instructions to Bidders, the Specifications, the Drawings, the Project Manual, all Change Orders and Field Orders issued hereafter, any other amendments hereto executed by the parties hereafter, together with the following (if any): Documents not enumerated in this Paragraph 1.2.1 are not Contract Documents and do not form part of this Contract. 1.3 ENTIRE AGREEMENT 1.3.1 This Contract, together with the Contractor's performance and payment bonds for the Project, all General Conditions, Special Conditions, Plans and Specifications, and Addenda attached thereto, constitute the entire and exclusive agreement between the Owner and the Contractor with reference to the Project. Specifically, but without limitation, this Contract supersedes any bid documents and all prior written or oral communications, representations and negotiations, if any, between the Owner and Contractor not expressly made a part hereof. 1.4 NO PRIVITY WITH OTHERS 1.4.1 Nothing contained in this Contract shall create, or be interpreted to create, privity or any other contractual agreement between the Owner and any person or entity other than the Contractor. 1.5 INTENT AND INTERPRETATION 1.5.1 The intent of this Contract is to require complete, correct and timely execution of the Work. Any Work that may be required, implied or inferred by the Contract Documents, or any one or more of them, as necessary to produce the intended result shall be provided by the Contractor for the Contract Price. 1.5.2 This Contract is intended to be an integral whole and shall be interpreted as internally consistent. What is required by any one Contract Document shall be considered as required by the Contract. 1.5.3 When a word, term or phrase is used in this Contract, it shall be interpreted or construed, first, as defined herein; second, if not defined, according to its generally accepted meaning in the construction industry; and third, if there is no generally accepted meaning in the construction industry, according to its common and customary usage. 1.5.4 The words "include", "includes", or "including", as used in this Contract, shall be deemed to be followed by the phrase, "without limitation". 1.5.5 The specification herein of any act, failure, refusal, omission, event, occurrence or condition as constituting a material breach of this Contract shall not imply that any other, non-specified act, failure, refusal, omission, event, occurrence or condition shall be deemed not to constitute a material breach of this Contract. 1.5.6 Words or terms used as nouns in this Contract shall be inclusive of their singular and plural forms, unless the context of their usage clearly requires a contrary meaning. 1.5.7 The Contractor shall have a continuing duty to read, carefully study and compare each of the Contract Documents, the Shop Drawings, the Product BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 3 Data, and any Plans and Specifications, and shall give written notice to the Owner of any inconsistency, ambiguity, error or omission which the Contractor may discover with respect to these documents before proceeding with the affected Work. The issuance, or the express or implied approval by the Owner or the Architect of the Contract Documents, Shop Drawings or Product Data shall not relieve the Contractor of the continuing duties imposed hereby, nor shall any such approval be evidence of the Contractor's compliance with this Contract. The Owner has requested the Architect to only prepare documents for the Project, including the Drawings and Specifications for the Project, which are accurate, adequate, consistent, coordinated and sufficient for construction. HOWEVER, THE OWNER MAKES NO REPRESENTATION OR WARRANTY OF ANY NATURE WHATSOEVER TO THE CONTRACTOR CONCERNING SUCH DOCUMENTS. By the execution hereof, the Contractor acknowledges and represents that it has received, reviewed and carefully examined such documents, has found them to be complete, accurate, adequate, consistent, coordinated and sufficient for construction, and that the Contractor has not, does not, and will not rely upon any representation or warranties by the Owner concerning such documents as no such representation or warranties have been or are hereby made. Further, the Contractor represents and warrants that it has had a sufficient opportunity to inspect the Project site and assumes any and all responsibility for inadequacies or ambiguities in the plans, drawings or specifications as well as for latent conditions of the site where the work is to be performed. 1.5.8 As between numbers and scaled measurements on the Drawings and in the Design, the numbers shall govern, as between larger scale and smaller scale drawings, the larger scale shall govern. 1.5.9 Neither the organization of any of the Contract Documents into divisions, sections, paragraphs, articles, (or other categories), nor the organization or arrangement of the Design, shall control the Contractor in dividing the Work or in establishing the extent or scope of the Work to be performed by Subcontractors. 1.6 OWNERSHIP OF CONTRACT DOCUMENTS 1.6.1 The Contract Documents, and each of them, shall remain the property of the Owner. The Contractor shall have the right to keep one record set of the Contract Documents upon completion of the Project; provided, however, that in no event shall Contractor use, or permit to be used, any or all of such Contract Documents on other projects without the Owner's prior written authorization. ARTICLE II THE WORK 2.1 The Contractor shall perform all of the Work required, implied or reasonably inferable from, this Contract. 2.2 WORK 2.2.1 The term "Work" shall mean whatever is done by or required of the Contractor to perform and complete its duties under this Contract, including the following: construction of the whole or a designated part of the Project; furnishing of any required surety bonds and insurance, and the provision or furnishing of labor, supervision, services, materials, supplies, equipment, fixtures, appliances, facilities, tools, transportation, storage, power, permits and licenses required of the Contractor, fuel, heat, light, cooling and all other utilities as required by this Contract. The Work to be performed by the Contractor is generally described as follows: 2.2.2 The Contractor shall be responsible for paying for and procuring all materials and labor and furnishing all services necessary or appropriate for the full performance of the Work and the for the full completion of the Project. All materials shall be new and materials and workmanship shall be of good quality. Upon request, the Contractor shall furnish BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 4 satisfactory proof of the type, kind, and quality of materials. ARTICLE III CONTRACT TIME 3.1 TIME AND LIQUIDATED DAMAGES 3.1.1 The Contractor shall commence the Work within 10 days of receipt of a written Notice to Proceed, and shall achieve Substantial Completion of the Work no later than ____ calendar days from the date specified in the Notice to Proceed. The parties acknowledge that time is of the essence in the performance of the terms of this Contract. The term “calendar days” shall mean any and all days of the week or month, no days being excepted. "Hours worked before 8:00 a.m. after 5:00 p.m., all weekends and holidays are subject to overtime. Overtime request must be made in writing and approved by the City of Coppell. Seventy-two hours notice required. All overtime incurred by the City for inspection services shall be paid by the Contractor. If not paid, such cost may be deducted from partial payments." It is contemplated by the parties that the progress of the Work may be delayed by certain conditions beyond the control of the parties; these delays have been contemplated by the parties and considered in the time allotted for performance specified herein and includes, but is not limited to delays occasioned on account of adverse weather, temporary unavailability of materials, shipment delays, and the presence and potential interference of other contractors who may be performing work at the Project site unrelated to this agreement. The number of calendar days from the date on which the Work is permitted to proceed, through the date set forth for Substantial Completion, shall constitute the "Contract Time". 3.1.2 The Contractor shall pay the Owner the sum of $_________ per day for each and every calendar day of unexcused delay in achieving Substantial Completion beyond the date set forth herein for Substantial Completion of the Work. Any sums due and payable hereunder by the Contractor shall be payable, not as a penalty, but as liquidated damages representing an estimate of delay damages likely to be sustained by the Owner, estimated at or before the time of executing this Contract. When the Owner reasonably believes that Substantial Completion will be inexcusably delayed, the Owner shall be entitled, but not required, to withhold from any amounts otherwise due the Contractor an amount then believed by the Owner to be adequate to recover liquidated damages applicable to such delays. if and when the Contractor overcomes the delay in achieving Substantial Completion, or any part thereof, for which the Owner has withheld payment, the Owner shall promptly release to the Contractor those funds withheld, but no longer applicable, as liquidated damages. 3.1.3 In the event that the Contractor achieves certification of substantial completion prior to the scheduled completion date, the Owner shall pay to the Contractor the sum of $_______ per day for each calendar day that substantial completion is certified in advance of the scheduled completion date. 3.1.4 No claim shall be made by the Contractor to the Owner, and no damages, costs or extra compensation shall be allowed or paid by the Owner to the Contractor for any delay or hindrance from any cause in the progress or completion of the Work or this Contract. The Contractor’s sole remedy in the event of any delay or hindrance shall be to request time extensions by written change orders as provided for hereinafter. Should the Contractor be delayed by an act of the Owner, or should the Owner order a stoppage of the Work for sufficient cause, an extension of time shall be granted by the Owner by written authorization upon written application, which extension shall not be unreasonably denied, to compensate for the delay. 3.1.5 The Owner shall have the authority to suspend the Work wholly or in part for such period or periods of time as it may deem appropriate due to unsuitable conditions considered unfavorable for the proper prosecution of the Work or for the failure of the Contractor to carry out instructions from the Owner or Owner’s representative. During any period in which the Work is stopped or during which any of the Work is not actively in progress for any reason, Contractor shall properly protect the site and the Work from damage, loss or harm. 3.2 SUBSTANTIAL COMPLETION 3.2.1 "Substantial Completion" shall mean that stage in the progression of the Work when the Work is sufficiently complete in accordance with this Contract that the Owner can enjoy beneficial use or occupancy of the Work and can utilize the Work for its intended purpose, even though minor BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 5 miscellaneous work and/or adjustment may be required. 3.3 TIME IS OF THE ESSENCE 3.3.1 All limitations of time set forth in the Contract Documents are of the essence of this Contract. ARTICLE IV CONTRACT PRICE 4.1 THE CONTRACT PRICE 4.1.1 The Owner shall pay, and the Contractor shall accept, as full and complete payment for all of the Work required herein, the fixed sum of $_______________. The sum set forth in this Paragraph 4.1 shall constitute the Contract Price which shall not be modified except by written Change Order as provided in this Contract. ARTICLE V PAYMENT OF THE CONTRACT PRICE 5.1 SCHEDULE OF VALUES 5.1.1 Within ten (10) calendar days of the effective date hereof, the Contractor shall submit to the Owner and to the Architect a Schedule of Values allocating the Contract Price to the various portions of the Work. The Contractor's Schedule of Values shall be prepared in such form, with such detail, and supported by such data as the Architect or the Owner may require to substantiate its accuracy. The Contractor shall not imbalance its Schedule of Values nor artificially inflate any element thereof. The violation of this provision by the Contractor shall constitute a material breach of this Contract. The Schedule of Values shall be used only as a basis for the Contractor's Applications for Payment and shall only constitute such basis after it has been acknowledged and accepted in writing by the Architect and the Owner. 5.2 PAYMENT PROCEDURE 5.2.1 The Owner shall pay the Contract Price to the Contractor as provided below. 5.2.2 PROGRESS PAYMENTS - Based upon the Contractor's Applications for Payment submitted to the Architect and upon Certificates for Payment subsequently issued to the Owner by the Architect, the Owner shall make progress payments to the Contractor on account of the Contract Price. 5.2.3 On or before the 25th day of each month after commencement of the Work, the Contractor shall submit an Application for Payment for the period ending the 15th day of the month to the Architect in such form and manner, and with such supporting data and content, as the Owner or the Architect may require. Therein, the Contractor may request payment for ninety percent (90%) of that portion of the Contract Price properly allocable to Contract requirements properly provided, labor, materials and equipment properly incorporated in the Work, less the total amount of previous payments received from the Owner. Such Application for Payment shall be signed by the Contractor and shall constitute the Contractor's representation that the Work has progressed to the level for which payment is requested in accordance with the Schedule of Values, that the Work has been properly installed or performed in full compliance with this Contract, and that the Contractor knows of no reason why payment should not be made as requested. Thereafter, the Architect will review the Application for Payment and may also review the Work at the Project site or elsewhere to determine whether the quantity and quality of the Work is as represented in the Application for Payment and is as required by this Contract. The Architect shall determine and certify to the Owner the amount properly owing to the Contractor. The Owner shall make partial payments on account of the Contract Price to the Contractor within thirty (30) days following the Architect's receipt and approval of each Application for Payment. The amount of each partial payment shall be the amount certified for payment by the Architect less such amounts, if any, otherwise owing by the Contractor to the Owner or which the Owner shall have the right to withhold as authorized by this Contract. The Architect's certification of the Contractor's Application for Payment shall not preclude the Owner from the exercise of any of its rights as set forth in Paragraph 5.3 hereinbelow. 5.2.4 The Contractor warrants that title to all Work covered by an Application for Payment will pass BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 6 to the Owner no later than the time of payment. The Contractor further warrants that upon submittal of an Application for Payment, all Work for which payments have been received from the Owner shall be free and clear of liens, claims, security interest or other encumbrances in favor of the Contractor or any other person or entity whatsoever. 5.2.5 The Contractor shall promptly pay each Subcontractor out of the amount paid to the Contractor on account of such Subcontractor's Work, the amount to which such Subcontractor is entitled. In the event the Owner becomes informed that the Contractor has not paid a Subcontractor as herein provided, the Owner shall have the right, but not the duty, to issue future checks in payment to the Contractor of amounts otherwise due hereunder naming the Contractor and such Subcontractor as joint payees. Such joint check procedure, if employed by the Owner, shall create no rights in favor of any person or entity beyond the right of the named payees to payment of the check and shall not be deemed to commit the Owner to repeat the procedure in the future. 5.2.6 No progress payment, nor any use or occupancy of the Project by the owner, shall be interpreted to constitute an acceptance of any Work not in strict accordance with this Contract. 5.3 WITHHELD PAYMENT 5.3.1 The Owner may decline to make payment, may withhold funds, and, if necessary, may demand the return of some or all of the amounts previously paid to the Contractor, to protect the Owner from loss because of: (a) defective Work not remedied by the Contractor nor, in the opinion of the Owner, likely to be remedied by the Contractor; (b) claims of third parties against the Owner or the Owner's property; (c) failure by the Contractor to pay Subcontractors or others in a prompt and proper fashion; (d) evidence that the balance of the Work cannot be completed in accordance with the Contract for the unpaid balance of the Contract Price, (e) evidence that the Work will not be completed in the time required for substantial or final completion; (f) persistent failure to carry out the Work in accordance with the Contract; (g) damage to the Owner or a third party to whom the Owner is, or may be, liable. In the event that the Owner makes written demand upon the Contractor for amounts previously paid by the Owner as contemplated in this Subparagraph 5.3.1, the Contractor shall promptly comply with such demand. The Owner shall have no duty to third parties to withhold payment to the Contractor and shall incur no liability for a failure to withhold funds. 5.4 UNEXCUSED FAILURE TO PAY 5.4.1 If within fifteen (15) days after the date established herein for payment to the Contractor by the Owner, the Owner, without cause or basis hereunder, fails to pay the Contractor any amount then due and payable to the Contractor, then the Contractor may after ten (10) additional days' written notice to the Owner and the Architect, and without prejudice to any other available rights or remedies it may have, stop the Work until payment of those amounts due from the Owner have been received. Late payments shall not accrue interest or other late charges. 5.5 SUBSTANTIAL COMPLETION 5.5.1 When the Contractor believes that the Work is substantially complete, the Contractor shall submit to the Architect a list of items to be completed or corrected. When the Architect on the basis of an inspection determines that the Work is in fact substantially complete, it will prepare a Certificate of Substantial Completion which shall establish the date of Substantial Completion, shall state the responsibilities of the Owner and the Contractor for Project security, maintenance, heat, utilities, damage to the Work, and insurance, and shall fix the time within which the Contractor shall complete the items listed therein. Guarantees required by the Contract shall commence on the date of Substantial Completion of the Work. The Certificate of Substantial Completion shall be submitted to the Owner and the Contractor for their written acceptance of the responsibilities assigned to them in such certificate. BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 7 Upon Substantial Completion of the Work, and execution by both the Owner and the Contractor of the Certificate of Substantial Completion, the Owner shall pay the Contractor an amount sufficient to increase total payments to the Contractor to one hundred percent (100%) of the Contract Price less three hundred percent (300%) of the reasonable cost as determined by the Owner and the Architect for completing all incomplete Work, correcting and bringing into conformance all defective and nonconforming Work, and handling all unsettled claims. 5.6 COMPLETION AND FINAL PAYMENT 5.6.1 When all of the Work is finally complete and the Contractor is ready for a final inspection, it shall notify the Owner and the Architect thereof in writing. Thereupon, the Architect will make final inspection of the Work and, if the Work is complete in full accordance with this Contract and this Contract has been fully performed, the Architect will promptly issue a final Certificate for Payment certifying to the Owner that the Project is complete and the Contractor is entitled to the remainder of the unpaid Contract Price, less any amount withheld pursuant to this Contract. If the Architect is unable to issue its final Certificate for Payment and is required to repeat its final inspection of the Work, the Contractor shall bear the cost of such repeat final inspection(s) which cost may be deducted by the Owner from the Contractor's final payment. 5.6.1.1 If the Contractor fails to achieve final completion within the time fixed therefor by the Architect in its Certificate of Substantial Completion, the Contractor shall pay the Owner the sum set forth hereinabove as liquidated damages per day for each and every calendar day of unexcused delay in achieving final completion beyond the date set forth herein for final completion of the Work. Any sums due and payable hereunder by the Contractor shall be payable, not as a penalty, but as liquidated damages representing an estimate of delay damages likely to be sustained by the Owner, estimated at or before the time of executing this Contract. When the Owner reasonably believes that final completion will be inexcusably delayed, the Owner shall be entitled, but not required, to withhold from any amounts otherwise due the Contractor an amount then believed by the Owner to be adequate to recover liquidated damages applicable to such delays. If and when the Contractor overcomes the delay in achieving final completion, or any part thereof, for which the Owner has withheld payment, the Owner shall promptly release to the Contractor those funds withheld, but no longer applicable, as liquidated damages. 5.6.2 The Contractor shall not be entitled to final payment unless and until it submits to the Architect its affidavit that all payrolls, invoices for materials and equipment, and other liabilities connected with the Work for which the Owner, or the Owner's property might be responsible, have been fully paid or otherwise satisfied; releases and waivers of lien from all Subcontractors of the Contractor and of any and all other parties required by the Architect or the Owner; consent of Surety, if any, to final payment. If any third party fails or refuses to provide a release of claim or waiver of lien as required by the Owner, the Contractor shall furnish a bond satisfactory to the Owner to discharge any such lien or indemnify the Owner from liability. 5.6.3 The Owner shall make final payment of all sums due the Contractor within ten (10) days of the Architect's execution of a final Certificate for Payment. 5.6.4 Acceptance of final payment shall constitute a waiver of all claims against the Owner by the Contractor except for those claims previously made in writing against the Owner by the Contractor, pending at the time of final payment, and identified in writing by the Contractor as unsettled at the time of its request for final payment. 5.6.5 Under no circumstance shall Contractor be entitled to receive interest on any payments or monies due Contractor by the Owner, whether the amount on which the interest may accrue is timely, late, wrongfully withheld, or an assessment of damages of any kind. ARTICLE VI THE OWNER 6.1 INFORMATION, SERVICES AND THINGS REQUIRED FROM OWNER 6.1.1 The Owner shall furnish to the Contractor, at the time of executing this Contract, any and all written and tangible material in its possession concerning conditions below ground at the site of the Project. BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 8 Such written and tangible material is furnished to the Contractor only in order to make complete disclosure of such material and for no other purpose. By furnishing such material, the Owner does not represent, warrant, or guarantee its accuracy either in whole, in part, implicitly or explicitly, or at all, and shall have no liability therefor. The Owner shall also furnish surveys, legal limitations and utility locations (if known), and a legal description of the Project site. 6.1.2 Excluding permits and fees normally the responsibility of the Contractor, the Owner shall obtain all approvals, easements, and the like required for construction and shall pay for necessary assessments and charges required for construction, use or occupancy of permanent structures or for permanent changes in existing facilities. 6.1.3 The Owner shall furnish the Contractor, free of charge, one copy of the Contract Documents for execution of the Work. 6.2 RIGHT TO STOP WORK 6.2.1 If the Contractor persistently fails or refuses to perform the Work in accordance with this Contract, or if the best interests of the public health, safety or welfare so require, the Owner may order the Contractor to stop the Work, or any described portion thereof, until the cause for stoppage has been corrected, no longer exists, or the Owner orders that Work be resumed. In such event, the Contractor shall immediately obey such order. 6.3 OWNER'S RIGHT TO PERFORM WORK 6.3.1 If the Contractor's Work is stopped by the Owner under Paragraph 6.2, and the Contractor fails within seven (7) days of such stoppage to provide adequate assurance to the Owner that the cause of such stoppage will be eliminated or corrected, then the Owner may, without prejudice to any other rights or remedies the Owner may have against the Contractor, proceed to carry out the subject Work. In such a situation, an appropriate Change Order shall be issued deducting from the Contract Price the cost of correcting the subject deficiencies, plus compensation for the Architect's additional services and expenses necessitated thereby, if any. If the unpaid portion of the Contract Price is insufficient to cover the amount due the Owner, the Contractor shall pay the difference to the Owner. ARTICLE VII THE CONTRACTOR 7.1 The Contractor is again reminded of its continuing duty set forth in Subparagraph 1.5.7. The Contractor shall perform no part of the Work at any time without adequate Contract Documents or, as appropriate, approved Shop Drawings, Product Data or Samples for such portion of the Work. If the Contractor performs any of the Work knowing it involves a recognized error, inconsistency or omission in the Contract Documents without such notice to the Architect, the Contractor shall bear responsibility for such performance and shall bear the cost of correction. 7.2 The Contractor shall perform the Work strictly in accordance with this Contract. 7.3 The Contractor shall supervise and direct the Work using the Contractor's best skill, effort and attention. The Contractor shall be responsible to the Owner for any and all acts or omissions of the Contractor, its employees and others engaged in the Work on behalf of the Contractor. 7.3.1 The Contractor shall give adequate attention to the faithful prosecution of the Work and the timely completion of this Contract, with authority to determine the manner and means of performing such Work, so long as such methods insure timely completion and proper performance. 7.3.2 The Contractor shall exercise all appropriate means and measures to insure a safe and secure jobsite in order to avoid and prevent injury, damage or loss to persons or property. 7.4 WARRANTY 7.4.1 The Contractor warrants to the Owner that all labor furnished to progress the Work under this Contract will be competent to perform the tasks undertaken, that the product of such labor will yield only first-class results, that materials and equipment furnished will be of good quality and new unless otherwise permitted by this Contract, and that the Work will be of good quality, free from faults and defects and in strict conformance with this Contract. All Work not conforming to these requirements may be considered defective. 7.5 The Contractor shall obtain and pay for all permits, fees and licenses necessary and ordinary BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 9 for the Work. The Contractor shall comply with all lawful requirements applicable to the Work and shall give and maintain any and all notices required by applicable law pertaining to the Work. 7.6 SUPERVISION 7.6.1 The Contractor shall employ and maintain at the Project site only competent supervisory personnel. Absent written instruction from the Contractor to the contrary, the superintendent shall be deemed the Contractor's authorized representative at the site and shall be authorized to receive and accept any and all communications from the Owner or the Architect. 7.6.2 Key supervisory personnel assigned by the Contractor to this Project are as follows: NAME FUNCTION ____________________ ____________________ ____________________ ____________________ ____________________ ____________________ ____________________ ____________________ ____________________ ____________________ So long as the individuals named above remain actively employed or retained by the Contractor, they shall perform the functions indicated next to their names unless the Owner agrees to the contrary in writing. In the event one or more individuals not listed above subsequently assume one or more of those functions listed above, the Contractor shall be bound by the provisions of this Subparagraph 7.6.2 as though such individuals had been listed above. 7.7 The Contractor, within fifteen (15) days of commencing the Work, shall submit to the Owner and the Architect for their information, the Contractor's schedule for completing the Work. The Contractor's schedule shall be revised no less frequently than monthly (unless the parties otherwise agree in writing) and shall be revised to reflect conditions encountered from time to time and shall be related to the entire Project. Each such revision shall be furnished to the Owner and the Architect. Failure by the Contractor to strictly comply with the provisions of this Paragraph 7.7 shall constitute a material breach of this Contract. 7.8 The Contractor shall continuously maintain at the site, for the benefit of the owner and the Architect, one record copy of this Contract marked to record on a current basis changes, selections and modifications made during construction. Additionally, the Contractor shall maintain at the site for the Owner and Architect the approved Shop Drawings, Product Data, Samples and other similar required submittals. Upon final completion of the Work, all of these record documents shall be delivered to the Owner. 7.9 SHOP DRAWINGS, PRODUCT DATA AND SAMPLES 7.9.1 Shop Drawings, Product Data, Samples and other submittals from the Contractor do not constitute Contract Documents. Their purpose is merely to demonstrate the manner in which the Contractor intends to implement the Work in conformance with information received from the Contract Documents. 7.9.2 The Contractor shall not perform any portion of the Work requiring submittal and review of Shop Drawings, Product Data or Samples unless and until such submittal shall have been approved by the Architect. Approval by the Architect, however, shall not be evidence that Work installed pursuant thereto conforms with the requirements of this Contract. 7.10 CLEANING THE SITE AND THE PROJECT 7.10.1 The Contractor shall keep the site reasonably clean during performance of the Work. Upon final completion of the Work, the Contractor shall clean the site and the Project and remove all waste, rubbish, temporary structures, and other materials together with all of the Contractor's property therefrom. Contractor shall dispose of all refuse at a Texas Natural Resource Conservation Commission approved landfill. The Contractor shall further restore all property damaged during the prosecution of the Work and shall leave the site in a clean and presentable condition. No additional payment shall be made by the Owner for this work, the compensation having been considered and included in the contract price. BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 10 7.11 ACCESS TO WORK AND INSPECTIONS 7.11.1 The Owner and the Architect shall have access to the Work at all times from commencement of the Work through final completion. The Contractor shall take whatever steps necessary to provide access when requested. When reasonably requested by the Owner or the Architect, the Contractor shall perform or cause to be performed such testing as may be necessary or appropriate to insure suitability of the jobsite or the Work’s compliance with the Contract requirements. All overtime incurred by the City for inspection services shall be paid by the Contractor. If not paid, such cost may be deducted from partial payments." 7.12 INDEMNITY AND DISCLAIMER 7.12.1 OWNER SHALL NOT BE LIABLE OR RESPONSIBLE FOR, AND SHALL BE INDEMNIFIED, DEFENDED, HELD HARMLESS AND RELEASED BY CONTRACTOR FROM AND AGAINST ANY AND ALL SUITS, ACTIONS, LOSSES, DAMAGES, CLAIMS, OR LIABILITY OF ANY CHARACTER, TYPE, OR DESCRIPTION, INCLUDING ALL EXPENSES OF LITIGATION, COURT COSTS, AND ATTORNEY'S FEES FOR INJURY OR DEATH TO ANY PERSON, OR INJURY OR LOSS TO ANY PROPERTY, RECEIVED OR SUSTAINED BY ANY PERSON OR PERSONS, INCLUDING THE CONTRACTOR, OR PROPERTY, ARISING OUT OF, OR OCCASIONED BY, DIRECTLY OR INDIRECTLY, THE PERFORMANCE OF CONTRACTOR UNDER THIS AGREEMENT, INCLUDING CLAIMS AND DAMAGES ARISING IN WHOLE OR IN PART FROM THE NEGLIGENCE OF OWNER, WITHOUT, HOWEVER, WAIVING ANY GOVERN-MENTAL IMMUNITY AVAILABLE TO THE OWNER UNDER TEXAS LAW AND WITHOUT WAIVING ANY DEFENSES OF THE PARTIES UNDER TEXAS LAW. THE PROVISIONS OF THIS INDEMNI-FICATION ARE SOLELY FOR THE BENEFIT OF THE PARTIES HERETO AND NOT INTENDED TO CREATE OR GRANT ANY RIGHTS, CONTRACTUAL OR OTHERWISE, TO ANY OTHER PERSON OR ENTITY. IT IS THE EXPRESSED INTENT OF THE PARTIES TO THIS AGREEMENT THAT THE INDEMNITY PROVIDED FOR IN THIS CONTRACT IS AN INDEMNITY EXTENDED BY CONTRACTOR TO INDEMNIFY AND PROTECT OWNER FROM THE CONSEQUENCES OF THE CONTRACTOR’S AS WELL AS THE OWNER'S NEGLIGENCE, WHETHER SUCH NEGLIGENCE IS THE SOLE OR PARTIAL CAUSE OF ANY SUCH INJURY, DEATH, OR DAMAGE. IN ADDITION, CONTRACTOR SHALL OBTAIN AND FILE WITH OWNER CITY OF COPPELL A STANDARD CERTIFICATE OF INSURANCE AND APPLICABLE POLICY ENDORSEMENT EVIDENCING THE REQUIRED COVERAGE AND NAMING THE OWNER CITY OF COPPELL AS AN ADDITIONAL INSURED ON THE REQUIRED COVERAGE. 7.12.2 The Contractor will secure and maintain Contractual Liability insurance to cover this indemnification agreement that will be primary and non-contributory as to any insurance maintained by the Owner for its own benefit, including self- insurance. In addition, Contractor shall obtain and file with Owner City of Coppell a Standard Certificate of Insurance and applicable policy endorsement evidencing the required coverage and naming the Owner City of Coppell as an additional insured on the required coverage. 7.12.3 In claims against any person or entity indemnified under this Paragraph 7.12 by an employee of the Contractor, a Subcontractor, anyone directly or indirectly employed by them or anyone for whose acts they may be liable, the indemnification obligation under this Paragraph 7.12 shall not be limited by a limitation on amount or type of damages, compensation or benefits payable by or for the Contractor or a Subcontractor under workers' compensation acts, disability benefit acts or other employee benefit acts. 7.13 NONDISCRIMINATION 7.13.1 The Contractor shall not discriminate in any way against any person, employee or job applicant on the basis of race, color, creed, national original, religion, age, sex, or disability where reasonable accommodations can be effected to enable the person to perform the essential functions of the job. The Contractor shall further insure that the foregoing nondiscrimination requirement shall be made a part and requirement of each subcontract on this Project. 7.14 PREVAILING WAGE RATES 7.14.1 The Contractor shall comply in all respects with all requirements imposed by any laws, ordinances or resolutions applicable to the Project with regard to the minimum prevailing wage rates for all classes of employees, laborers, subcontractors, BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 11 mechanics, workmen and persons furnishing labor and services to the Project. The City of Coppell has adopted a Prevailing Wage Rate Schedule, available to the Contractor by request, which specifies the classes and wage rates to be paid to all persons. The Contractor shall pay not less than the minimum wage rates established thereby for each class, craft or type of labor, workman, or mechanic employed in the execution of this Contract. The failure of the Contractor to comply with this requirement shall result in the forfeiture to the City of Coppell of a sum of not less than Sixty Dollars ($60.00) for each person per day, or portion thereof, that such person is paid less than the prevailing rate. Upon request by the Owner, Contractor shall make available for inspection and copying its books and records, including but not limited to its payroll records, account information and other documents as may be required by the Owner to insure compliance with this provision. 7.15 JOB SITE SAFETY PRECAUTIONS 7.15.1 The Contractor shall at all times exercise reasonable precautions for the safety of its employees, laborers, subcontractors, mechanics, workmen and others on and near the jobsite and shall comply with all laws, ordinances, regulations, and standards of federal, state and local safety laws and regulations. The Contractor shall provide such machinery guards, safe walk-ways, ladders, bridges, and other safety devices as may be necessary or appropriate to insure a safe and secure jobsite and shall require its subcontractors to comply with this requirement. The Contractor shall immediately comply with any and all safety requirements imposed by the Architect during the progress of the Work. 7.16 WARNING DEVICES AND BARRICADES 7.16.1 The Contractor shall furnish and maintain such warning devices, barricades, lights, signs, pavement markings, and other devices as may be necessary or appropriate or required by the Architect to protect persons or property in, near or adjacent to the jobsite, including . No separate compensation shall be paid to the Contractor for such measures. Where the Work is being conducted in, upon or near streets, alleys, sidewalks, or other rights-of-way, the Contractor shall insure the placement, maintenance and operation of any and all such warning devices as may be required by the City of Coppell and shall do so until no longer required by the City. Such devices shall be in compliance with and conform to the manual and specifications for the uniform system of traffic control devices adopted by the Texas Department of Transportation. 7.17 PROTECTION OF UTILITIES AND OTHER CONTRACTORS 7.17.1 The Contractor shall use best efforts to leave undisturbed and uninterrupted all utilities and utility services provided to the jobsite or which presently exists at, above or beneath the location where the Work is to be performed. In the event that any utility or utility service is disturbed or damaged during the progress of the Work, the Contractor shall forthwith repair, remedy or restore the utility at Contractor’s sole expense. 7.17.2 The Contractor understands and acknowledges that other contractors of the Owner or of other entities may be present at the jobsite performing other work unrelated to the Project. The Contractor shall use best efforts to work around other contractors without impeding the work of others while still adhering to the completion date established herein. In the event that the Contractor’s work is or may be delayed by any other person, the Contractor shall immediately give notice thereof to the Architect and shall request a written Change Order in accordance with the procedures set forth by this Contract. The Contractor’s failure to provide such notice and to request such Change Order shall constitute a waiver of any and all claims associated therewith. ARTICLE VIII CONTRACT ADMINISTRATION 8.1 THE ARCHITECT 8.1.1 When used in this Contract the term “Architect” does not necessarily denote a duly licensed, trained or certified architect; as used herein, the term shall be used interchangeably and shall mean a designated Architect, Engineer, or Contract Administrator (who may not be an architect or engineer) for the Owner, said person to be designated or redesignated by the Owner prior to or at any time during the Work hereunder. The Architect may be an employee of the Owner or may be retained by the Owner as an independent contractor but, in either event, the Architect’s duties and authority shall be as BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 12 set forth hereinafter. The Contractor understands and agrees that it shall abide by the decisions and instructions of the Architect notwithstanding the contractual relationship between the Owner and Architect. All of the Owner’s instructions to the Contractor shall be through the Architect. In the event the Owner should find it necessary or convenient to replace the Architect, the Owner shall retain a replacement Architect and the status of the replacement Architect shall be that of the former Architect. 8.2 ARCHITECT'S ADMINISTRATION 8.2.1 The Architect, unless otherwise directed by the Owner in writing, will perform those duties and discharge those responsibilities allocated to the Architect as set forth in this Contract. The Architect shall be the Owner's representative from the effective date of this Contract until final payment has been made. 8.2.2 The Owner and the Contractor shall communicate with each other in the first instance through the Architect. 8.2.3 The Architect shall be the initial interpreter of the requirements of the drawings and specifications and the judge of the performance thereunder by the Contractor. The Architect shall render written or graphic interpretations necessary for the proper execution or progress of the Work with reasonable promptness on request of the Contractor. 8.2.4 The Architect will review the Contractor's Applications for Payment and will certify to the Owner for payment to the Contractor, those amounts then due the Contractor as provided in this Contract. 8.2.5 The Architect shall have authority to reject Work which is defective or does not conform to the requirements of this Contract. If the Architect deems it necessary or advisable, the Architect shall have authority to require additional inspection or testing of the Work for compliance with Contract requirements. 8.2.6 The Architect will review and approve, or take other appropriate action as necessary, concerning the Contractor's submittals including Shop Drawings, Product Data and Samples. Such review, approval or other action shall be for the sole purpose of determining conformance with the design concept and information given through the Contract Documents. 8.2.7 The Architect will prepare Change Orders and may authorize minor changes in the Work by Field Order as provided elsewhere herein. 8.2.8 The Architect shall, upon written request from the Contractor, conduct inspections to determine the date of Substantial Completion and the date of final completion, will receive and forward to the Owner for the Owner's review and records, written warranties and related documents required by this Contract and will issue a final Certificate for Payment upon compliance with the requirements of this Contract. 8.2.9 The Architect's decisions in matters relating to aesthetic effect shall be final if consistent with the intent of this Contract. 8.3 CLAIMS BY THE CONTRACTOR 8.3.1 The Architect shall determine all claims and matters in dispute between the Contractor and Owner with regard to the execution, progress, or sufficiency of the Work or the interpretation of the Contract Documents, including but not limited to the plans and specifications. Any dispute shall be submitted in writing to the Architect within seven (7) days of the event or occurrence or the first appearance of the condition giving rise to the claim or dispute who shall render a written decision within a reasonable time thereafter. The Architect’s decisions shall be final and binding on the parties. In the event that either party objects to the Architect’s determination as to any submitted dispute, that party shall submit a written objection to the Architect and the opposing party within ten (10) days of receipt of the Architect’s written determination in order to preserve the objection. Failure to so object shall constitute a waiver of the objection for all purposes. 8.3.2 Pending final resolution of any claim of the Contractor, the Contractor shall diligently proceed with performance of this Contract and the Owner shall continue to make payments to the Contractor in accordance with this Contract. 8.3.3 CLAIMS FOR CONCEALED, LATENT OR UNKNOWN CONDITIONS - The Contractor expressly represents that it has been provided with an adequate opportunity to inspect the Project site and thoroughly review the Contract Documents and plans and specifications prior to submission of its bid and the Owner’s acceptance of the bid. Subject to the BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 13 conditions hereof, Contractor assumes full responsibility and risk for any concealed, latent or unknown condition which may affect the Work. No claims for extra work or additional compensation shall be made by Contractor in connection with concealed, latent or unknown conditions except as expressly provided herein. Should concealed, latent or unknown conditions encountered in the performance of the Work (a) below the surface of the ground or (b) in an existing structure be at variance with the conditions indicated by this Contract, or should unknown conditions of an unusual nature differing materially from those ordinarily encountered in the area and generally recognized as inherent in Work of the character provided for in this Contract, be encountered, the Contract Price shall be equitably adjusted by Change Order upon the written notice and claim by either party made within seven (7) days after the first observance of the condition. As a condition precedent to the Owner having any liability to the Contractor for concealed or unknown conditions, the Contractor must give the Owner and the Architect written notice of, and an opportunity to observe, the condition prior to disturbing it. The failure by the Contractor to make the written notice and claim as provided in this Subparagraph shall constitute a waiver by the Contractor of any claim arising out of or relating to such concealed, latent or unknown condition and the Contractor thereby assumes all risks and additional costs associated therewith. 8.3.4 CLAIMS FOR ADDITIONAL COSTS - If the Contractor wishes to make a claim for an increase in the Contract Price, as a condition precedent to any liability of the Owner therefor, the Contractor shall give the Architect written notice of such claim within seven (7) days after the occurrence of the event, or the first appearance of the condition, giving rise to such claim. Such notice shall be given by the Contractor before proceeding to execute any additional or changed Work. The failure by the Contractor to give such notice and to give such notice prior to executing the Work shall constitute a waiver of any claim for additional compensation. 8.3.4.1 In connection with any claim by the Contractor against the Owner for compensation in excess of the Contract Price, any liability of the Owner for the Contractor's costs shall be strictly limited to direct costs incurred by the Contractor and shall in no event include indirect costs or consequential damages of the Contractor. The Owner shall not be liable to the Contractor for claims of third parties, including Subcontractors. The Owner shall not be liable to the Contractor for any claims based upon delay to the Contractor for any reason whatsoever including any act or neglect on the part of the Owner. 8.3.5 CLAIMS FOR ADDITIONAL TIME - If the Contractor is delayed in progressing any task which at the time of the delay is then critical or which during the delay becomes critical, as the sole result of any act or neglect to act by the Owner or someone acting in the Owner's behalf, or by changes ordered in the Work, unusual delay in transportation, unusually adverse weather conditions not reasonably anticipated, fire or any causes beyond the Contractor's control, then the date for achieving Substantial Completion of the Work shall be extended upon the written notice and claim of the Contractor to the Owner and the Architect, for such reasonable time as the Architect may determine. Any notice and claim for an extension of time by the Contractor shall be made not more than seven (7) days after the occurrence of the event or the first appearance of the condition giving rise to the claim and shall set forth in detail the Contractor's basis for requiring additional time in which to complete the Project. In the event the delay to the Contractor is a continuing one, only one notice and claim for additional time shall be necessary. If the Contractor fails to make such claim as required in this Subparagraph, any claim for an extension of time shall be waived. The procedures and remedies provided by this provision shall be the sole remedy of Contractor and Contractor shall not assert nor be entitled to any additional delays or damages associated therewith. 8.4 FIELD ORDERS 8.4.1 The Architect shall have authority to order minor changes in the Work not involving a change in the Contract Price or in Contract Time and not inconsistent with the intent of the Contract. Such changes shall be effected by Field Order and shall be binding upon the Contractor. The Contractor shall carry out such Field Orders promptly. 8.5 MEDIATION 8.5.1 In the event that a dispute arises under the terms of this Contract, following an adverse determination by the Architect and proper preservation of the issue as required herein, the parties agree to submit to mediation. In such event, the parties shall agree to a designated person to serve as mediator and each party shall be responsible for payment of one-half of the total mediation fees. The parties shall submit the dispute to mediation as soon as practical and in no event later than one (1) year after the Architect’s written decision on the matter. At least one BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 14 designated representative of each party must attend and participate in good faith in an effort to resolve the matters in dispute. 8.5.2 In no event shall the foregoing provision justify or authorize any delay in the progress of the Work; the parties shall abide by the decision of the Architect in accomplishing the timely completion of the Project. ARTICLE IX SUBCONTRACTORS 9.1 DEFINITION 9.1.1 A Subcontractor is an entity which has a direct contract with the Contractor to perform a portion of the Work. No Subcontractor shall be in privity with the Owner. 9.2 AWARD OF SUBCONTRACTS 9.2.1 Upon execution of the Contract, the Contractor shall furnish the Owner, in writing, the names of persons or entities proposed by the Contractor to act as a Subcontractor on the Project. The Owner shall promptly reply to the Contractor, in writing, stating any objections the Owner may have to such proposed Subcontractor. The Contractor shall not enter into a subcontract with a proposed Subcontractor with reference to whom the Owner has made timely objection. The Contractor shall not be required to subcontract with any party to whom the Contractor has objection. 9.2.2 All subcontracts shall afford the Contractor rights against the Subcontractor which correspond to those rights afforded to the Owner against the Contractor herein, including those rights afforded to the Owner by Subparagraph 12.2.1 below. All subcontracts shall incorporate by reference the provisions hereof and shall provide that no claims, causes or demands shall be made by any Subcontractor against the Owner. 9.2.3 The Contractor shall indemnify, defend and hold harmless the Owner from and against any and all claims, demands, causes of action, damage, and liability asserted or made against the Owner by or on behalf of any Subcontractor. ARTICLE X CHANGES IN THE WORK 10.1 CHANGES PERMITTED 10.1.1 Changes in the Work within the general scope of this Contract, consisting of additions, deletions, revisions, or any combination thereof, may be ordered without invalidating this Contract, by Change Order or by Field Order. 10.1.2 Changes in the Work shall be performed under applicable provisions of this Contract and the Contractor shall proceed promptly with such changes. 10.2 CHANGE ORDER DEFINED 10.2.1 Change Order shall mean a written order to the Contractor executed by the Owner and the Architect, issued after execution of this Contract, authorizing and directing a change in the Work or an adjustment in the Contract Price or the Contract Time, or any combination thereof. The Contract Price and the Contract Time may be changed only by written Change Order. 10.3 CHANGES IN THE CONTRACT PRICE 10.3.1 Any change in the Contract Price resulting from a Change Order shall be determined as follows: (a) by mutual agreement between the Owner and the Contractor as evidenced by (1) the change in the Contract Price being set forth in the Change Order, (2) such change in the Contract Price, together with any conditions or requirements related thereto, being initialed by both parties and (3) the Contractor's execution of the Change Order, or (b) if no mutual agreement occurs between the Owner and the Contractor, then, as provided in Subparagraph 10.3.2 below. 10.3.2 If no mutual agreement occurs between the Owner and the Contractor as contemplated in Subparagraph 10.3.1 above, the change in the Contract Price, if any, shall then be determined by the Architect on the basis of the reasonable expenditures or savings of those performing, deleting or revising the Work attributable to the change, including, in the case of an increase or decrease in the Contract Price, a reasonable allowance for direct job site overhead and profit. In such case, the Contractor shall present, in such form BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 15 and with such content as the Owner or the Architect requires, an itemized accounting of such expenditures or savings, plus appropriate supporting data for inclusion in a Change Order. Reasonable expenditures or savings shall be limited to the following: reasonable costs of materials, supplies, or equipment including delivery costs, reasonable costs of labor, including social security, old age and unemployment insurance, fringe benefits required by agreement or custom, and workers' compensation insurance, reasonable rental costs of machinery and equipment exclusive of hand tools whether rented from the Contractor or others, reasonable costs of premiums for all bonds and insurance, permit fees, and sales, use or other taxes related to the Work, and reasonable cost of direct supervision and jobsite field office overhead directly attributable to the change. In no event shall any expenditure or savings associated with the Contractor's home office or other non-jobsite overhead expense be included in any change in the Contract Price. Pending final determination of reasonable expenditures or savings to the Owner, payments on account shall be made to the Contractor on the Architect's Certificate for Payment. 10.3.3 If unit prices are provided in the Contract, and if the quantities contemplated are so changed in a proposed Change Order that application of such unit prices to the quantities of Work proposed will cause substantial inequity to the Owner or to the Contractor, the applicable unit prices shall be equitably adjusted. 10.4 MINOR CHANGES 10.4.1 The Architect shall have authority to order minor changes in the Work not involving a change in the Contract Price or an extension of the Contract Time and not inconsistent with the intent of this Contract. Such minor changes shall be made by written Field Order, and shall be binding upon the owner and the Contractor. The Contractor shall promptly carry out such written Field Orders. 10.5 EFFECT OF EXECUTED CHANGE ORDER 10.5.1 The execution of a Change Order by the Contractor shall constitute conclusive evidence of the Contractor's agreement to the ordered changes in the Work, this Contract as thus amended, the Contract Price and the Contract Time. The Contractor, by executing the Change Order, waives and forever releases any claim against the Owner for additional time or compensation for matters relating to or arising out of or resulting from the Work included within or affected by the executed Change Order. 10.6 NOTICE TO SURETY; CONSENT 10.6.1 The Contractor shall notify and obtain the consent and approval of the Contractor's surety with reference to all Change Orders if such notice, consent or approval are required by the Contractor's surety or by law. The Contractor's execution of the Change Order shall constitute the Contractor's warranty to the Owner that the surety has been notified of and consents to, such Change Order and the surety shall be conclusively deemed to have been notified of such Change Order and to have expressly consented thereto. ARTICLE XI UNCOVERING AND CORRECTING WORK 11.1 UNCOVERING WORK 11.1.1 If any of the Work is covered contrary to the Architect's request or to any provisions of this Contract, it shall, if required by the Architect or the Owner, be uncovered for the Architect's inspection and shall be properly replaced at the Contractor's expense without change in the Contract Time. 11.1.2 If any of the Work is covered in a manner not inconsistent with Subparagraph 11.1.1 above, it shall, if required by the Architect or Owner, be uncovered for the Architect's inspection. If such Work conforms strictly with this Contract, costs of uncovering and proper replacement shall by Change Order be charged to the Owner. If such Work does not strictly conform with this Contract, the Contractor shall pay the costs of uncovering and proper replacement. 11.2 CORRECTING WORK 11.2.1 The Contractor shall immediately proceed to correct Work rejected by the Architect as defective or failing to conform to this Contract. The Contractor shall pay all costs and expenses associated with correcting such rejected Work, including any additional testing and inspections, and reimbursement to the Owner for the Architect's services and expenses made necessary thereby. BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 16 11.2.2 If within one (1) year after Substantial Completion of the Work any of the Work is found to be defective or not in accordance with this Contract, the Contractor shall correct it promptly upon receipt of written notice from the Owner. This obligation shall survive final payment by the Owner and termination of this Contract. With respect to Work first performed and completed after Substantial Completion, this one year obligation to specifically correct defective and nonconforming Work shall be extended by the period of time which elapses between Substantial Completion and completion of the subject Work. 11.2.3 Nothing contained in this Paragraph 11.2 shall establish any period of limitation with respect to other obligations which the Contractor has under this Contract. Establishment of the one year time period in Subparagraph 11.2.2 relates only to the duty of the Contractor to specifically correct the Work. 11.3 OWNER MAY ACCEPT DEFECTIVE OR NONCONFORMING WORK 11.3.1 If the Owner chooses to accept defective or nonconforming Work, the Owner may do so. In such event, the Contract Price shall be reduced by the greater of (a) the reasonable cost of removing and correcting the defective or nonconforming Work, and (b) the difference between the fair market value of the Project as constructed and the fair market value of the Project had it not been constructed in such a manner as to include defective or nonconforming Work. If the remaining portion of the unpaid Contract Price, if any, is insufficient to compensate the Owner for its acceptance of defective or nonconforming Work, the Contractor shall, upon written demand from the Owner, pay the Owner such remaining compensation for accepting defective or nonconforming Work. ARTICLE XII CONTRACT TERMINATION 12.1 TERMINATION BY THE CONTRACTOR 12.1.1 If the Work is stopped for a period of ninety (90) days by an order of any court or other public authority, or as a result of an act of the Government, through no fault of the Contractor or any person or entity working directly or indirectly for the Contractor, the Contractor may, upon ten (10) days' written notice to the Owner and the Architect, terminate performance under this Contract and recover from the Owner payment for the actual reasonable expenditures of the Contractor (as limited in Subparagraph 10.3.2 above) for all Work executed and for materials, equipment, tools, construction equipment and machinery actually purchased or rented solely for the Work, less any salvage value of any such items. 12.1.2 If the Owner shall persistently or repeatedly fail to perform any material obligation to the Contractor for a period of fifteen (15) days after receiving written notice from the Contractor of its intent to terminate hereunder, the Contractor may terminate performance under this Contract by written notice to the Architect and the Owner. In such event, the Contractor shall be entitled to recover from the Owner as though the Owner had terminated the Contractor's performance under this Contract for convenience pursuant to Subparagraph 12.2.1 hereunder. 12.2 TERMINATION BY THE OWNER 12.2.1 FOR CONVENIENCE 12.2.1.1 The Owner may for any reason whatsoever terminate performance under this Contract by the Contractor for convenience. The Owner shall give written notice of such termination to the Contractor specifying when termination becomes effective. 12.2.1.2 The Contractor shall incur no further obligations in connection with the Work and the Contractor shall stop Work when such termination becomes effective. The Contractor shall also terminate outstanding orders and subcontracts. The Contractor shall settle the liabilities and claims arising out of the termination of subcontracts and orders. The Owner may direct the Contractor to assign the Contractor's right, title and interest under terminated orders or subcontracts to the Owner or its designee. 12.2.1.3 The Contractor shall transfer title and deliver to the Owner such completed or partially completed Work and materials, equipment, parts, fixtures, information and Contract rights as the Contractor has. 12.2.1.4 (a) The Contractor shall submit a termination claim to the Owner and the Architect specifying the amounts due because of the termination for convenience together with costs, pricing or other data required by the Architect. If the Contractor fails to file BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 17 a termination claim within one (1) year from the effective date of termination, the Owner shall pay the Contractor, an amount derived in accordance with subparagraph (c) below. (b) The Owner and the Contractor may agree to the compensation, if any, due to the Contractor hereunder. (c) Absent agreement to the amount due to the Contractor, the Owner shall pay the Contractor the following amounts: (i) Contract prices for labor, materials, equipment and other services accepted under this Contract; (ii) Reasonable costs incurred in preparing to perform and in performing the terminated portion of the Work, and in terminating the Contractor's performance, plus a fair and reasonable allowance for overhead and profit thereon (such profit shall not include anticipated profit or consequential damages), provided however, that if it appears that the Contractor would have not profited or would have sustained a loss if the entire Contract would have been completed, no profit shall be allowed or included and the amount of compensation shall be reduced to reflect the anticipated rate of loss, if any; (iii) Reasonable costs of settling and paying claims arising out of the termination of subcontracts or orders pursuant to Subparagraph 12.2.1.2 of this Paragraph. These costs shall not include amounts paid in accordance with other provisions hereof. The total sum to be paid the Contractor under this Subparagraph 12.2.1 shall not exceed the total Contract Price, as properly adjusted, reduced by the amount of payments otherwise made, and shall in no event include duplication of payment. 12.2.2 FOR CAUSE 12.2.2.1 If the Contractor persistently or repeatedly refuses or fails to prosecute the Work in a timely manner, abandons the jobsite and fails to resume work within five (5) days of written notice thereof by the Owner, fails to grant or allow access to the jobsite by the Owner or Architect, fails to supply enough properly skilled workers, supervisory personnel or proper equipment or materials, fails to make prompt payment to Subcontractors or for materials or labor, persistently disregards laws, ordinances, rules, regulations or orders of any public authority having jurisdiction, or otherwise is guilty of a violation of a material provision of this Contract, then the Owner may by written notice to the Contractor, without prejudice to any other right or remedy, terminate the employment of the Contractor and take possession of the site and of all materials, equipment, tools, construction equipment and machinery thereon owned by the Contractor and may finish the Work by whatever methods it may deem expedient. In such case, the Contractor shall not be entitled to receive any further payment until the Work is finished. 12.2.2.2 If the unpaid balance of the Contract Price does not exceed the cost of finishing the work, including compensation for the Architect's additional services and expenses made necessary thereby, such difference shall be paid by the Contractor to the Owner. This obligation for payment shall survive the termination of the Contract. 12.2.2.3 In the event the employment of the Contractor is terminated by the Owner for cause pursuant to Subparagraph 12.2.2 and it is subsequently determined by a Court of competent jurisdiction that such termination was without cause, such termination shall thereupon be deemed a Termination for Convenience under Subparagraph 12.2.1 and the provisions of Subparagraph 12.2.1 shall apply. ARTICLE XIII INSURANCE 13.1 CONTRACTOR SHALL MAINTAIN INSURANCE 13.1.1 The Contractor at his own expense shall purchase, maintain and keep in force during the life of this contract, adequate insurance that will protect the Contractor and/or any Additional Insured from claims which may arise out of or result from operations under this contract. The insurance required shall provide adequate protections from all claims, whether such operations be by the Contractor or by any Additional BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 18 Insured or by any Subcontractor or by anyone directly or indirectly employed by any of them, or by anyone whose acts of any of them may be liable and from any special hazards, such as blasting, which may be encountered in the performance of this contract in the amounts as shown below in Paragraph 13.2.1. 13.1.2 The Contractor shall not commence work on any Contract in the City of Coppell until the Contractor has obtained all the insurance required under this paragraph and such insurance has been approved by the City. 13.2 TYPES AND AMOUNTS OF CONTRACTOR’S INSURANCE 13.2.1. The Contractor shall furnish and maintain during the life of the contract adequate Worker's Compensation and Commercial General Liability (Public) Insurance in such amounts as follows: Type of Insurance Amount Worker's Compensation as set forth in the Worker's Compensation Act. Commercial General $1,000,000 Each Accident/Occurrence. Liability (Public) $1,000,000 Aggregate $1,000,000 Products & Completed Operations Aggregate. Owner’s Protective $600,000 per occurrence Liability Insurance $1,000,000 aggregate Excess/Umbrella Liability $1,000,000 per occurrence w/drop down coverage Endorsement CG 2503 Amendment Aggregate Limit of Insurance per Project or Owner's and Contractor's Protective Liability Insurance for the Project. Automobile Liability $500,000 Combined single limit per occurrence. 13.3 ADDITIONAL INSURED The Owner shall be named as an additional insured on the Commercial General Liability (Public), Owner’s Protective Liability, and Excess/Umbrella Liability Insurance Policies furnished by the Contractor. 13.4 WRITTEN NOTIFICATION Each insurance policy shall contain a provision requiring that thirty (30) days prior to expiration, cancellation, non-renewal or any material change in coverage, a notice there of shall be given by certified mail to the Division of Purchasing, City of Coppell, 255 Parkway Blvd., Coppell, Texas, 75019. 13.5 PREMIUMS AND ASSESSMENTS Companies issuing the insurance policies shall have no recourse against the City for payment of any premiums or assessments for any deductibles which are at the sole responsibility and risk of the Contractor. 13.6 CERTIFICATE OF INSURANCE Proof that the insurance is in force shall be furnished to the City on City of Coppell Standard Certificate of Insurance Forms. In the event any insurance policy shown on the Certificate of Insurance has an expiration date that is prior to the completion and final acceptance of the project by the City of Coppell, the contractor shall furnish the City proof of identical continued coverage no later than thirty(30) days prior to the expiration date shown on the Certificate of Insurance. 13.7 PRIMARY COVERAGE The coverages provided herein shall be primary and noncontributory with any other insurance maintained by the City of Coppell, Texas, for its benefit, including self insurance. 13.8 WORKER’S COMPENSATION INSURANCE COVERAGE 13.8.1 The Contractor shall: (1) provide coverage for its employees providing services on a project, for the duration of the project based on proper reporting of classification codes and payroll amounts and filing of any coverage agreements; BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 19 (2) provide a certificate of coverage showing workers' compensation coverage to the governmental entity prior to beginning work on the project; (3) provide the governmental entity prior to the end of the coverage period, a new certificate of coverage showing extension of coverage, if the coverage period shown on the contractor's current certificate of coverage ends during the duration of the project; (4) obtain from each person providing services on a project, and provide to the governmental entity: (A) a certificate of coverage, prior to that person beginning work on the project, so the governmental entity will have on file certificates of coverage showing coverage for all persons providing services on the project; and (B) no later than seven days after receipt by the contractor, a new certificate of coverage showing extension of coverage, if the coverage period shown on the current certificate of coverage ends during the duration of the project; (5) retain all required certificates of coverage on file for the duration of the project and for one year thereafter; (6) notify the governmental entity in writing by certified mail or personal delivery, within 10 days after the contractor knew or should have known, of any change that materially affects the provision of coverage of any person providing services on the project; (7) post a notice on each project site informing all persons providing services on the project that they are required to be covered, and stating how a person may verify current coverage and report failure to provide coverage. This notice does not satisfy other posting requirements imposed by the Act or other commission rules. This notice must be printed with a title in at least 30 point bold type and text in at least 19 point normal type, and shall be in both English and Spanish and any other language common to the worker population. The text for the notices shall be the following text provided by the Texas Worker’s Compensation Comm-ission on the sample notice, without any additional words or changes: REQUIRED WORKERS' COMPENSATION COVERAGE "The law requires that each person working on this site or providing services related to this construction project must be covered by workers' compensation insurance. This includes persons providing, hauling, or delivering equipment or materials, or providing labor or transportation or other service related to the project, regardless of the identity of their employer or status as an employee." "Call the Texas Workers' Compensation Commission at 512-440-3789 to receive information on the legal requirement for coverage, to verify whether your employer has provided the required coverage, or to report an employer's failure to provide coverage." and (8) contractually require each person with whom it contracts to provide services on a project, to: (A) provide coverage based on proper reporting of classification codes and payroll amounts and filing of any coverage agreements for all of its employees providing services on the project, for the duration of the project; (B) provide a certificate of coverage to the contractor prior to that person beginning work on the project; (C) include in all contracts to provide services on the project the language in subsection (e)(3) of this rule; (D) provide the Contractor, prior to the end of the coverage period, a new certificate of coverage showing extension of coverage, if the coverage period shown on the current certificate of coverage ends during the duration of the project; BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 20 (E) obtain from each other person with whom it contracts, and provide to the Contractor: (i) a certificate of coverage, prior to the other person beginning work on the project; and (ii) prior to the end of the coverage period, a new certificate of coverage showing extension of the coverage period, if the coverage period shown on the current certificate of coverage ends during the duration of the project; (F) retain all required certificates of coverage on file for the duration of the project and for one year thereafter; (G) notify the governmental entity in writing by certified mail or personal delivery, within 10 days after the person knew or should have known, of any change that materially affects the provision of coverage of any person providing services on the project; and (H) contractually require each other person with whom it contracts, to perform as required by sub- paragraphs (A) - (H) of this paragraph, with the certificate of coverage to be provided to the person for whom they are providing services. ARTICLE XIV MISCELLANEOUS 14.1 LAWS AND ORDINANCES 14.1.1 The Contractor shall at all times and in all respects observe and comply with all federal, state and local laws, ordinances, and regulations applicable to the Project and Work. The Contractor shall further insure that all Subcontractors observe and comply with said laws, ordinances and regulations. 14.2 GOVERNING LAW 14.2.1 The Contract shall be governed by the laws of the State of Texas. Venue for any causes of action arising under the terms or provisions of this Contract or the Work to be performed hereunder shall be in the courts of Dallas County, Texas. 14.3 SUCCESSORS AND ASSIGNS 14.3.1 The Owner and Contractor bind themselves, their successors, assigns and legal representatives to the other party hereto and to successors, assigns and legal representatives of such other party in respect to covenants, agreements and obligations contained in this Contract. The Contractor shall not assign this Contract without written consent of the Owner. 14.4 SURETY BONDS 14.4.1 If the Contract Price exceeds the sum of $50,000.00, the Contractor shall furnish separate performance and payment bonds to the Owner, according to the requirements set out in the bid documents and state statutes to guaranty full and faithful performance of the Contract and the full and final payment of all persons supplying labor or materials to the Project. Each bond required by the bid documents or state statute shall set forth a penal sum in an amount not less than the Contract Price. Each bond furnished by the Contractor shall incorporate by reference the terms of this Contract as fully as though they were set forth verbatim in such bonds. In the event the Contract Price is adjusted by Change Order executed by the Contractor, the penal sum of both the performance bond and the payment bond shall be deemed increased by like amount. The performance and payment bonds furnished by the Contractor shall be in form suitable to the Owner and shall be executed by a surety, or sureties, reasonably suitable to the Owner and authorized to do business in the State of Texas by the State Board of Insurance. 14.4.2 If the Contract Price exceeds the sum of $50,000.00, the Contractor, upon execution of the Contract and prior to commencement of the Work, shall furnish to the Owner a two-year maintenance bond in the amount of one hundred percent (100%) of the Contract Price covering the guaranty and maintenance prescribed herein, written by an approved surety authorized and duly licensed to conduct BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 21 business in the State of Texas. The cost of said maintenance bond shall be included in the Contractor’s unit bid prices and shall be paid by the Contractor. 14.5 SEVERABILITY 14.5.1 The provisions of this Contract are herein declared to be severable; in the event that any term, provision or part hereof is determined to be invalid, void or unenforceable, such determination shall not affect the validity or enforceability of the remaining terms, provisions and parts, and this Contract shall be read as if the invalid, void or unenforceable portion had not be included herein. 14.6 AMENDMENTS 14.6.1 This Contract may be amended by the parties only by a written agreement duly executed by both parties. The failure of the Owner to object to any nonperformance or nonconforming work or to enforce any provision hereof shall in no event be regarded as or construed to be a waiver, release or modification of any term or provision in this Contract, nor shall such failure to object or enforce estop the Owner from insisting on strict compliance with this Contract or from recovering damages, costs or expenses arising as a result of such nonperformance or nonconforming work. 14.7 NOTICES 14.6.1 All notices required by this Contract shall be presumed received when deposited in the mail properly addressed to the other party or Architect at the address set forth herein or set forth in a written designation of change of address delivered to all parties and the Architect. BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 22 EXECUTED in single or multiple originals, this _____ day of ______________, 20____. CITY OF COPPELL CONTRACTOR: APPROVED: ___________________________________ _________________________________ City Manager (Signature) _________________________________ (Type/Print Name and Title) ATTEST: __________________________________ (Street Address) ___________________________________ __________________________________ City Secretary (City/State/Zip) ATTEST: ___________________________________ BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 23 CORPORATE ACKNOWLEDGMENT THE STATE OF ____________________ COUNTY OF ______________________ BEFORE ME, the undersigned authority, a Notary Public in and for said County and State, on this day personally appeared: _______________________________ _______________________________ (Print Name) (Print Title) of _____________________________, the Contractor designated hereinabove, known to me to be the person and officer whose name is subscribed to the foregoing instrument and acknowledged to me that the same was the act of the said Contractor, a corporation, that he was duly authorized to perform the same by appropriate resolution of the board of directors of such corporation and that he executed the same as the act and deed of such corporation for the purposes and consideration therein expressed, and in the capacity therein stated. GIVEN UNDER MY HAND AND SEAL OF OFFICE this the _____ day of ________________, A.D., 20__. __________________________________________ Notary Public In and For __________________County, _________________ My Commission expires: _________________ CITY MANAGER’S ACKNOWLEDGMENT THE STATE OF TEXAS COUNTY OF DALLAS BEFORE ME, the undersigned authority, a Notary Public in and for said County and State, on this day personally appeared the undersigned, City Manager of the City of Coppell, Texas, a municipal corporation, known to me to be the person and officer whose name is subscribed to the foregoing instrument and acknowledged to me that the same was the act of the said City of Coppell, Texas, a municipal corporation, that he/she was duly authorized to perform the same by appropriate resolution of the City Council of the City of Coppell and that he/she executed the same as the act of the said City for purpose and consideration therein expressed, and in the capacity therein stated. GIVEN UNDER MY HAND AND SEAL OF OFFICE this _____ day of ____________, A.D., 20___. __________________________________ Notary Public in and for the State of Texas My Commission expires: __________________ BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 24 PERFORMANCE BOND STATE OF TEXAS § COUNTY OF DALLAS § KNOW ALL MEN BY THESE PRESENTS: That ________________________________________________________________whose address is ______________________________________________________________________________ hereinafter called Principal, and ____________________________________________________, a corporation organized and existing under the laws of the State of _______________ and fully licensed to transact business in the State of Texas, as Surety, are held and firmly bound unto the CITY OF COPPELL, TEXAS a municipal corporation organized and existing under the laws of the State of Texas, a municipal corporation organized and existing under the laws of the State of Texas, hereinafter called "Owner”, in the penal sum of ___________________________________ ________________________________________________ dollars ($_____________ ) in lawful money of the United States, to be paid in Dallas County, Texas, for the payment of which sum well and truly to be made, we bind ourselves, our heirs, executors, administrators and successors jointly and severally, firmly by these presents. This Bond shall automatically be increased by the amount of any Change Order or Supplemental Agreement which increases the Contract price, but in no event shall a Change Order or Supplemental Agreement which reduces the Contract price decrease the penal sum of this Bond. THE OBLIGATION TO PAY SAME is conditioned as follows: Whereas, the Principal entered into a certain Contract with the City of Coppell, the Owner, dated the __________ day of ___________, 20__, which is made a part hereof by reference, for the construction of certain public improvements that are generally described as follows: Construction of the : SAMPLE Project No. DR ________ Bid No. ___________ NOW, THEREFORE, if the Principal shall well, truly and faithfully perform and fulfill all of the undertakings, covenants, terms, conditions and agreements of said Contract in accordance with the plans, specifications and Contract documents during the original term thereof and any extension thereof which may be granted by the Beneficiary, with or without notice to the Surety, and during the life of any guaranty or warranty required under this Contract, and shall also well and truly perform and fulfill all the undertakings, covenants, terms, conditions and agreements of any and all duly authorized modifications of said Contract that may hereafter be made, notice of which modifications to the Surety being hereby waived; and, if the Principal shall repair and/or replace all defects due to faulty materials and workmanship that appear within a period of one (1) year from the date of final completion and final acceptance of the Work by Owner; and, if the Principal shall fully indemnify and save harmless the Beneficiary from all costs and damages which Beneficiary may suffer by reason of failure to so perform herein and shall fully reimburse and repay Beneficiary all outlay and expense which the Beneficiary may incur in making good any default of deficiency, then this obligation shall be void; otherwise, it shall remain in full force and effect. PROVIDED FURTHER, that if any legal action be filed on this Bond, exclusive Venue shall lie in Dallas County, Texas. BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 25 AND PROVIDED FURTHER, that the said Surety, for value received, hereby stipulates and agrees that no change, extension of time, alteration or addition to Contract or to the Work performed thereunder, or the specifications accompanying the same shall in anyway affect its obligation on this Bond, and it does hereby waive notice of any such change, extension of time, alteration or addition to the terms of the Contract, or to the Work or to the Specifications. This Bond is given pursuant to the provisions of Article 5160 of Vernon's Annotated Civil Statutes, and any other applicable statues of the State of Texas. The undersigned and designated agent is hereby designated by the Surety herein as the Resident Agent in Tarrant County or Dallas County to whom any requisite notices may be delivered and on whom service of process may be had in matters arising out of such suretyship, as provided by Article 7.19-1 of the Insurance Code, Vernon's Annotated Civil Statutes of the State of Texas. IN WITNESS WHEREOF, this instrument is executed in ___________copies, each one of which shall be deemed an original, this, the__________ day of ________________., 20___. PRINCIPAL SURETY ___________________________________ By: __________________________ By: Title ______________________________ Title: ATTEST: ATTEST: The Resident Agent of the Surety in Dallas or Denton County, Texas, for delivery of notice and service of the process is: NAME: _________________________________________________________________________ ADDRESS __________________________________________________________________ NOTE: Date of Performance Bond must be date of Contract If Resident Agent is not a corporation, give a person's name. BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 26 PAYMENT BOND STATE OF TEXAS § COUNTY OF DALLAS § KNOW ALL MEN BY THESE PRESENTS: That ________________________________________________________________whose address is ______________________________________________________________________________ hereinafter called Principal, and ____________________________________________________, a corporation organized and existing under the laws of the State of _______________ and fully licensed to transact business in the State of Texas, as Surety, are held and firmly bound unto the CITY OF COPPELL, TEXAS a municipal corporation organized and existing under the laws of the State of Texas, a municipal corporation organized and existing under the laws of the State of Texas, hereinafter called "Owner”, in the penal sum of ___________________________________ ________________________________________________ dollars ($_____________ ) in lawful money of the United States, to be paid in Dallas County, Texas, for the payment of which sum well and truly to be made, we bind ourselves, our heirs, executors, administrators and successors jointly and severally, firmly by these presents. This Bond shall automatically be increased by the amount of any Change Order or Supplemental Agreement which increases the Contract price, but in no event shall a Change Order or Supplemental Agreement which reduces the Contract price decrease the penal sum of this Bond. THE OBLIGATION TO PAY SAME is conditioned as follows: Whereas, the Principal entered into a certain Contract with the City of Coppell, the Owner, dated the __________ day of ___________, 20__, which is made a part hereof by reference, for the construction of certain public improvements that are generally described as follows: Construction of the : SAMPLE Project No. DR ________ Bid No. ___________ NOW, THEREFORE, if the Principal shall well, truly and faithfully perform and fulfill its duties and make prompt payment to all persons, firms, subcontractors, corporations and claimants supplying labor and/or material in the prosecution of the Work provided for in said Contract and any and all duly authorized modifications of said Contract that may hereafter be made. notice of which modification to the Surety is hereby expressly waived; the this obligation shall be void; otherwise it shall remain in full force and effect. PROVIDED FURTHER, that if any legal action be filed on this Bond, exclusive Venue shall lie in Dallas County, Texas. AND PROVIDED FURTHER, that the said Surety, for value received, hereby stipulates and agrees that no change, extension of time, alteration or addition to Contract or to the Work performed thereunder, or the Plans, Specifications, Drawings, etc., accompanying the same, shall in anywise affect its obligation on this Bond, and it does hereby waive notice of any such change, extension of time, alteration or addition to the terms of the Contract, or to the Work to be performed thereunder. BID Q-SAMPLE SAMPLE CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page 27 This Bond is given pursuant to the provisions of Article 5160 of Vernon's Annotated Civil Statutes, and any other applicable statues of the State of Texas. The undersigned and designated agent is hereby designated by the Surety herein as the Resident Agent in Tarrant County or Dallas County to whom any requisite notices may be delivered and on whom service of process may be had in matters arising out of such suretyship, as provided by Article 7.19-1 of the Insurance Code, Vernon's Annotated Civil Statutes of the State of Texas. IN WITNESS WHEREOF, this instrument is executed in ___________copies, each one of which shall be deemed an original, this, the__________ day of ________________., 20___. PRINCIPAL SURETY ___________________________________ By: __________________________ By: Title ______________________________ Title: ATTEST: ATTEST: The Resident Agent of the Surety in Dallas or Denton County, Texas, for delivery of notice and service of the process is: NAME: _________________________________________________________________________ ADDRESS __________________________________________________________________ NOTE: Date of Payment Bond must be date of Contract If Resident Agent is not a corporation, give a person's name. ! !"#$% !"& "# $#% # # "!'"'"! (( & # '%# ) "$ !%"$ "' $ "$'"$ *+$,+'-'+ !%"$ '$.) "$ - %'"$""+"'% %"$$ "'"! '"$.% "$ - /0!$'"$.#"-$+$1'"$""+")'"!2$''$ )'$'+$-"3"$. '4'"!$.'$1"!$ +$"+ +%"$ ! # (#%# ) "$, 1% '-, '$ - -1$ !%"$- '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # (5('$ "+' -+, '$ "' $ "$'"$ *+$,+'-'+ !%"$ '$.) "$- %'"$""+" '% %"$$ "'"! '"$.% "$ -/0!$'"$. #"-$+$1'"$""+")'"!2$''$)'$'+$-"3"$. '4'"!$.'$1"!$ +$"+ +%"$ ,%% % % ! $%#&# / %# !# /,## ! .# 0 # 1# #& (#%)# !# # ! % 0% -, 1 MEMORANDUM To: Mayor and City Council From: Kent Collins, P.E., Director of Public Works Date: November 13, 2018 Reference: Dallas County Project Specific Agreement (Various locations) 2030: Sustainable City Government, Goal 3 Excellent and Well-maintained City Infrastructure and Facilities General Information: x This agreement encompasses the city limits. x Includes asphalt repairs, ditch grading and crack sealing. x The total amount is $150,000 annually. Introduction: This agenda item is being presented for approval to enter into a Project Specific Agreement (PSA) with Dallas County for maintenance and improvements to various streets within the City limits. Analysis: Dallas County has performed asphalt maintenance for the City in previous years under a similar agreement. Under previous agreements, each time the county was to perform asphalt repairs or ditch grading for the City, a project specific agreement has been required for each individual road that required Dallas County Commissioners Court approval. This agreement allows for flexibility to request maintenance work by the County on any street within the city limits. This added flexibility will allow the City and the County to work together in a more efficient manner to address resident needs. In accordance with the Master Interlocal Agreement that was approved by Council in 2017 and renewed every 5 years, the city will fund 100% of the cost of labor and materials for this work and Dallas County will supply the equipment and personnel to perform the work. Dallas County Road and Bridge crews have completed many similar projects for the city in the past with cost effectively and with good results. Legal Review: This Project Specific Agreement was reviewed by the attorneys. 2 Fiscal Impact: The approval of this agreement will have a financial impact of $150,000 as provided for by the infrastructure maintenance fund and drainage utility district fund. Recommendation: The Public Works Department recommends approval of this agreement. ! !"#$% !"& "# $#% # # "!'"'"! (( & # '%# )*+ '"! !% "' ," + "$+$ '$-. $ "+$/',$'"!" 0$1''2$' "#"+$ , %""$$'(%*+ '"! !%'"$- % "$ ,3$- !-"#"$ +!%"$ '$-$-'$ ,4" ''51!$'"$-#",$+$)'"$""+6"5"$- '2'"! $-'$)"!$ '!"""+ +%"$ ! # (#%# . $)% ,78%"$/'"! 0'+ ).98::, '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # (8('$ "+' -+, '$ "' ," + "$+$ '$-. $ "+$/',$'"!"0$1''2$' "#"+$ , %""$$'(%*+ '"! !%'"$-% "$ ,3$- !-" #"$ +!%"$ '$-$-'$ ,4"''51!$'"$-#",$+$ )'"$""+6"5"$- '2'"!$-'$)"!$ '!"""+ +%"$ 0%% % % -,'+'%+$ ,$-'!"'$%'31!$'"$-#",$+$ )'"$""+6" ! ! $%#&# -1'+; 9$%"$+ %%" ,$-'+ "$+$ '$-. $ "+$ /',$'"!<0$1''2$' "#"+ / %# !# /,## 1 MEMORANDUM To: Mayor and City Council From: Kent Collins, P.E., Director of Public Works Date: November 13, 2018 Reference: Pavement Leveling Annual Contract 2030: Sustainable City Government, Goal 3 Excellent and Well-maintained City Infrastructure and Facilities General Information: x This request is a renewal of the annual contract for concrete lifting & stabilization x The City has utilized this program for street repairs/mudjacking successfully in the past to eliminate areas of ponding water due to paving settling x Methods for preventive maintenance are much more cost effective in extending the life of the pavement Introduction: This agenda item is being presented for approval to utilize the City of Grand Prairie’s contract with Nortex Concrete Lifting and Stabilization, Inc., as authorized by the Texas Local Government Code, Section 271.102, to perform our yearly street repair/mud jacking program. Analysis: To provide well-maintained City infrastructure, our concrete streets and alleys require some lifting and leveling occasionally. When water ponds in the gutter line, but the street is still in good shape, concrete slab lifting will be employed to allow positive drainage. This is considered preventative maintenance and will extend the life of the street. In addition to lifting and leveling to solve minor drainage issues, this same technique and product can be used to level slabs on multi-lane roadways when slabs are uneven. Belt Line Road south of Southwestern is a good example where differential settling occurs when the subgrade has voids created by water infiltration and reinforcing between joints has deteriorated. Nortex provides these services using a polyurethane foam injection method commonly referred to as “Uretek” injection. The City has been using the Uretek method for leveling streets and alleys for over 15 years in the form of annual maintenance contracts. 2 This contract has a unit price of $3.93 per lb. of foam, with a total contract amount of $100,000.00. Legal Review: The Purchasing Department has reviewed the documents and determined that this is an appropriate method of contracting with this firm. Fiscal Impact: The fiscal impact of this agenda item is $100,000.00, as budgeted. Recommendation: The Public Works Department recommends approval of this contract with Nortex Concrete Lifting & Stabilization, Inc. !"#$% !"& !" #"$ " " '$ "(' )) % " &$" *% +,#,-.-/#0 &#,12 "' 3.&4*5( 6*%6'"!7 "'"! (8"!9$3 %.4*5:"". %"$4'"! *%'5;$ .&4*5:"". %"$&' 4'"!*%'5;$ '$8.$'4'$"" "'$' "$ %'$$8 %"$ 3'"!3%' $""'":;( %% " $ "( 3" ($ "$8" $8' 34"/ & '%$3$" $8$ 34$3& :$";$$89$ 3."$ " /" %"/$"( 6*%/$6'"! "$6//""<( <( 5 ('$ " '"$" ( "('( %% 3/$$&9$'"!$6'"! "$'.(%634$33& $.&4*5 3.$'4'$"38'6'$ . "'$' "3 &$(" '"$" )"* "$ '$+ ) ,*+ &$" # #" " &$"* -% ! " ))""'"!5= "'"! %%'' " ))'$ "(' $ "))'$ "(' ))'$ "(' $ "))'$ "(' >)>)'$ "(' $ "))'$ "(' )>)'$ "(' ,*+ '$ +,#,-.-/#0 &#,12 "' 3.&4*5( 6*%6'"!7 "'"!(8"!9$3 % .4*5:"". %"$4'"!*%'5;$ .&4*5 :"". %"$&'4'"!*%'5;$ '$8.$'4'$"" "'$' "$ %'$$8 %"$ 3'"!3%' $""'":;( %% " $ " ( 3" ($ "$8" $8' 34"/ & '%$3$ " $8$ 34$3& :$";$$89$ 3."$ " /" %"/$" ( 6*%/$6'"!"$6//""<( <( 5 ('$ 4%% #$"%" 8 '("$ 8 9$ " $8 "$' $8 .(%6 $8 "(' %$'"! $ $8 $$"'"!' +" +($ 6 '$ "(' $6 ( "'$' " 3 $8' 9$ '$8 $8 6'( 8'"! 3$ ""$', %6> +" 4$%6 '$ "(' $6 ( "'$' " 3 $8' 9$ '$8 $8 6'( 8'"!3$ ""$'+($ 6 +" !$ '$ "(' $6 ( "'$' " 3 $8' 9$ '$8 $8 6'( 8'"! 3$ ""$'4$%6 +" ? $8 ""'"! " = "'"! %%'' " ""'% ( %%" .&4*)( 6*% '$8 $$"'"!( "'$' " 8""'"!.$%"$9$$8$$8''$%6$6"$'$8.(%6 "('@$'"! . $" 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference:Consider tabling the consideration of PD-259R-SF-7/9, Blackberry Farm, to permit the development of 74 single-family lots and nine (9) common area lots, on 54.8 acres of property located at the North side of Sandy Lake Road, 750 feet northeast of Starleaf Road from November 13, 2018 to December 11, 2018. 2030: Special Place to Live Executive Summary: Since the initial tabling of this request in August, the applicant has made significant progress in addressing the drainage, engineering and open space preservation issues. However, there are several items that need to be confirmed. Staff has been assured that this additional 30 days will allow the issues to be adequately addressed. Staff sent 127 notices to property owners within 200 and 800 feet notifying them of the November hearing date and we have received one homeowner inquiry. Notices will not be required to be sent again if this request is tabled to a specific date. Introduction: The existing PD was approved in 2013 for 82 lots, six common area lots, and a significant list of PD conditions, many related to flood plain, grading and drainage. The current request is similar to the existing PD, except that: x Number of lots has been reduced from 82 to74; x the common areas have increased from approximately 24 acres to 30 acres to accommodate the drainage issues (6 to 9 common areas); and x this is will be a two-phase request, Phase 1 including 54 lots and 8 common areas, Phase 2, 20 lots with one common area. x Most of the conditions relating to the requirement for flood and drainage studies have been addressed, as the CLOMR has been approved by FEMA and detail site and engineering plans have been revised to reflect the recommendations. x However, stream bank erosion protection requires approval by the US Army Corps of Engineers and that issue remains outstanding. 2 Analysis: The applicant has requested another delay until the December 11th Council meeting to address these outstanding issues. October 9th Council approved the tabling of the public hearing to November 13, 2018 to address these outstanding issues. Staff sent notices to 137 property owners notifying them of this hearing date. On September 11, 2018 City Council tabled consideration of this request, with the public hearing left open until October 9th. On August 14, 2018 City Council tabled consideration of this request, with the public hearing left open until September 11, 2018. On July 19, 2018,the Planning and Zoning Commission unanimously recommended Approval PD-259R- SF-7/9, Blackberry Farm with outstanding conditions. Legal Review: This did not require city attorney review Fiscal Impact: None Recommendation: The Planning Department requests that this item be tabled until the December 11, 2018, Council Meeting, with the public hearing left open. Attachments: 1. Letter requesting table until December 11 th 2. Staff Report 3. Site Plan 4. Exhibit “A” – PD Conditions ITEM # 4 Page 1 of 4 CITY OF COPPELL PLANNING DEPARTMENT STAFF REPORT CASE NO.: PD-259R-SF-7/9, Blackberry Farm P&Z HEARING DATE: July 19, 2018 C.C. HEARING DATE: August 14, 2018 STAFF REP.: Marcie Diamond, Assistant Director of Community Development/Planning LOCATION: North side of Sandy Lake Road, 750 feet northeast of Starleaf Road SIZE OF AREA: 54.8 acres of property CURRENT ZONING: PD-259-SF-7/9 (Planned Development-259-Single Family-7 & 9) REQUEST: A zoning change to PD-259R-SF-7/9 (Planned Development-259 Revised -Single Family-7 & 9), to permit the development of 74 single-family lots and nine (9) common area lots. APPLICANT:Blackberry Farms, LLC David Hayes Holmes Builders 225 State Highway 121, Suite 120 Coppell, Texas 75019 (214) 488-5200 Email: dhayes@theholmesbuilders.com HISTORY: In early 1999, this applicant applied for rezoning from SF-12 to PD–SF-9 on 28.21 acres of this request area to develop 55 residential lots. At that time substantial neighborhood opposition surfaced, staff had a number of concerns, and the Planning Commission unanimously denied the request. The case was appealed to Council and was denied by that body in March. The same applicant has acquired additional land from Carrollton in 2012 (Carrollton has dis-annexed and Coppell annexed the property), an adjacent property owner, and enlarged the request area by 26.6 acres for a total of 54.8 acres. In 2013 City Council approved PD-259-SF-7/9 for 82 single-family lots and 6 common areas subject to various conditions, including Flood Plain Study and a tree mitigation fee of $125,000 being paid prior to construction. A detailed comparison of the revised request and the current request is included in the staff analysis. Preliminary Plats and Final Plats for this property were approved in 2014 and again in 2016, all of which have expired. ITEM # 4 Page 2 of 4 TRANSPORTATION: Sandy Lake Road is an improved, C4D/6, four-lane divided thoroughfare in a six-lane right-of-way (110 feet). SURROUNDING LAND USE & ZONING: North: vacant flood plain, City of Carrollton South: St. Joseph’s Village; PD-114 (SF-7) East: Single-family home; SF-12 West: landscape nursery; “R” Retail and Single Family; “SF-7” COMPREHENSIVE PLAN: Coppell 2030, A Comprehensive Master Plan, shows this property as Residential Neighborhood and Floodplain DISCUSSION: As stated in the HISTORY section of this report, a PD for 55 lot single-family development was denied 1999 a portion of this land area. There was substantial neighborhood opposition as well as concerns from staff regarding emergency access to the property. During 2012-13 this applicant enlarged the area of request through the annexation from the City of Carrollton and acquiring additional land from an adjacent property owner. The existing PD was approved for 82 lots, six common area lots, and a significant list of PD Conditions. This current request is similar to the existing PD, except that: x Number of lots has been reduced from 82 to74; x the common areas have increased from approximately 24 acres to 30 acres to accommodate the drainage issues (6 to 9 common areas); and x this is proposed to be a two-phase request, Phase 1 including 54 lots and 8 common areas, Phase 2, 20 lots with one common area. x Most of the conditions relating to the requirement for flood and drainage studies have been deleted, as the CLOMR has been approved by FEMA and detail site and engineering plans have been revised to reflect the recommendations, such as single-family lots not extending into the floodplain areas, increased drainage areas which shall be maintained by the HOA (not being part of the platted residential lots), the provision of a 10’ wide private drainage easement along a portion of the west property line, etc. However, prior to the filing of the Final Plat for this property, additional determination may be required in relation to the location of the retaining walls and the overall maintenance of the drainage area. x The applicant is requesting an additional condition which allows for a variance to the Erosion Hazard Setback Ordinance, which was adopted in 2015 after the original PD was established on this property. The application’s rationale for a variance to this ordinance is as follows: “The erosion hazard setback was implemented after this subdivision was originally designed. With the original design of this subdivision, there was a slope stability analysis conducted that was taken into consideration with the design for the flood plain, retaining walls and lot filling so that no homes would be located in slope failure zone. That is one of the reasons the retaining walls are set back from the top of creek banks by at least 30 feet. The exhibit shows the erosion hazard setback to fall in the rear yards of some of the lots, but ITEM # 4 Page 3 of 4 nothing greater than the rear yard setback of twenty feet. There is no impact on the proposed homes. Additional staff review of the Erosion Control Setback Exhibit prior to filing the Final Plat of Phase One is included as PD Condition. Stream bank erosion protection will require approval by the US Army Corps of Engineers. No Final Plats may be filed or work shall commence prior to that approval. x The following conditions will also be part of this amended PD: o Homeowners Association shall be responsible to maintain the stabilization along the creek bank of Denton Creek from erosion. Each lot owner shall be notified and provide a hold harmless agreement by separate instrument that the City and Developer are not liable for future erosion of the creek bank, and o The Homeowners Association shall be responsible to maintain the storage basins/ponds being constructed with the development. Other requested revisions to the PD Conditions, as established in the existing ordinance, include the following: o Deletion of the requirement for a 3-home separation between stucco homes o Allowance for detached buildings in front yard – see discussion below o Deletion of the option for rolled curbs o Deletion of the Hike and Bike Trail (internal to the site) o Revision of the bridge over the creek from dual to a single arch o Elimination of the option for pedestrian easement connecting Blackberry Farms to the residential subdivision to the west, as it appears that there was not an agreement of the respective landowners. Tree Mitigation The original request included a detailed tree survey and mitigation plan, which based on the ordinance at that time, and fees were determined to be in the range of $600,000. In response to the applicant’s requested reduction in mitigation fees to $600.00, City Council granted a mitigation fee of $125,000. This PD condition shall be carried forward to this PD request. Outstanding Issues Entry Feature/Common Area Lot 2X The current PD includes Detail Plans for the construction of entry features (stone wall with signage and entry arches) and a 1.125-acre tract common area (Lot 2X), which was envisioned to be a teaching laboratory—a mini-farm. Specifically, the Detail Plan indicated a Farm House, Blackberry Patch, landscaping, circular drive and limited parking, which was attached to the Ordinance as Exhibits “C-3 and C- 4”. Additionally, the existing PD contains the following condition: The farm house at the subdivision entrance will not be used or occupied as a residence or retail business, except occasional sales of seasonal botanical gardening materials. Staff is recommending that for clarity, these exhibits and conditions are made part of this revised PD Ordinance and an additional condition be added that requires: ITEM # 4 Page 4 of 4 The development of Lot 2X and the entry features be constructed prior to the issuance of a building permit for the first home, other than a model home. Finally, along the north and east side of Lot 2X is the a 15’ wide paved private drive which provides for emergency access to this subdivision. This additional private drive was required given this development will only have one access point onto Sandy Lake Road. Structures in the Front Yard There is an existing PD Condition which reads as follows: “Detached buildings and hardscapes shall be permitted in front yard, but must be behind the twenty-five (25) foot front building setback”. Staff expressed concern about the implications of the implementation of this condition, and upon re-submission the applicant provided the following wording. “Hardscapes consisting of masonry, wood, stucco where home is stucco and/or metal courtyard wingwalls and screening to a maximum height of eight (8) feet shall be permitted in front yard, but must be behind the 25- foot front yard setback”. While conceptually staff could support some sort of PD condition allowing for appropriately designed front yard fencing, additional clarification is needed as to the purpose and intent of this condition, and (as previously requested) more details of this concept. Staff requested pictures of some examples where this has been built. Overall, the proposal meets the objectives of the Comprehensive Plan in that the development is residential in nature, and reflects the land use contemplated by the Plan, conditions of approval . RECOMMENDATION TO THE PLANNING AND ZONING COMMISSION: Staff is recommending APPROVAL of this request subject to the PD conditions, as revised as attached Exhibit “A”, and the attachment of the Entry Feature/Common Area Lot 2X Exhibits. ALTERNATIVES: 1. Recommend approval of the request 2. Recommend disapproval of the request 3. Recommend modification of the request 4. Take under advisement for reconsideration at a later date ATTACHMENTS: 1. Exhibit “A” – PD Conditions 2. Site Plan 3. Landscape Plan 4. Retaining/Screening Wall Locations 5. Erosion Hazard Setback Exhibit 6. Bridge Exhibit 7.Entry Feature/Common Area Lot 2X Phone (214) 473-4640 (888) 937-5150TBPLS Firm Reg. No. 100743012740 Dallas Pkwy., Ste. 280Plano, TX 75093westwoodps.comWestwood Professional Services, Inc.TBPE Firm Reg. No. 11756 EXHIBIT “A” PLANNED DEVELOPMENT CONDITIONS - PD-“SF-9” AND “SF-7” A. The exterior of a maximum of 18 single family residences in this development shall be permitted to be constructed with stucco exterior finish in lieu of masonry as provided in the Comprehensive Zoning Ordinance. Stucco as used in this ordinance shall be defined as continuous plaster or mortar of seven-eighths (7/8”) of an inch thickness over wood frame with metal lath and elastomeric topcoat. All single family residences permitted to be of stucco material or plaster shall be of earth tone color. B. Minimum 25-foot front building line shall be provided for all single family lots. C. Homes to be built on Lot 1 and Lot 20 in Block D shall have a minimum size of 2,800 square feet. D. Sidewalks will be constructed at time of house construction on all single family lots. E. No alley will be provided for any Lots. F. Hardscapes consisting of masonry, wood, stucco where home is stucco, and/or metal courtyard wingwalls and screening to a maximum height of eight (8) feet shall be permitted in front yard, but must be behind the 25-foot front building setback. Additional clarification is required. G. A drainage flood study approved by the City Engineer will be required with the submission of prior to the filing of aa Ffinal Pp lat for Phase 1 of for this development. Stream bank erosion protection will require approval by the US Army Corps of Engineers. No Final Plats may be filed or work shall commence prior to that approval. H. There will be a minimum side yard setback of 5 feet on Lots 1 through 20, Block D. I. The center island in the cul-de-sac at the east end of Persimmon Drive shall be constructed of cobblestone patterned concrete and shall be maintained by the Homeowners Association. J. The Homeowners Association shall be responsible to maintain the stabilization along the creek bank of Denton Creek from erosion. Each Lot Owner shall be notified and provide a hold harmless agreement by separate instrument that the City and Developer are not liable for future erosion of the creek bank. K. The Homeowners Association shall be responsible to maintain the storage basins/ponds being constructed with the development. L. Tree mitigation fees of $125,000 must be paid prior to construction. M. Park fees are required in the amount of $1285 per lot. N. The creek crossing shall be a concrete single arch culvert with a stone pattern and textured concrete or natural stone veneer and a steel rail on a reinforced concrete base. O. This project is not subject to the Erosion Hazard Setback per City Ordinance, Sec. 13-9-1, G- 20. a. Staff will review of the Erosion Control Setback Exhibit prior to filing the Final Plat of Phase One P.Retaining Walls are to be constructed of stone and maintained by the lot owner. If the owner fails to maintain the wall, the Homeowners Association has the right to repair the wall and assess the lot owner. City has no responsibility for the retaining walls on private property. Q. There will be additional comments at the time of Detail Engineering Review. R. Detail Site and Landscape Plan for Lot 2X and the screening wall entry feature shall be attached to this PD and shall be subject to: a. The farm house at the subdivision entrance will not be used or occupied as a residence or retail business, except occasional sales of seasonal botanical gardening materials. b. The development of Lot 2X and the entry features be constructed prior to the issuance of a building permit for the first home, other than a model home. ! !"#$% !"& "# $#% # # ""'"!() "'"! %%'' " ** & # '%# +,&" -.#/ &#012 "' 3+,&"4 "'"!56"!7$3 % +,&8""+ %"$,&' %%5'9$ +,&8""+ %"$,&'' " %%5'9$ $:'6+$';'$"3 5 ""'"5$ "!% " 5 3 $ 5$$$6" $6$5 " 3;+"$ ""$ .'"& 8;+"$ "& 9$$67$ 3<=>$#"5 :'"!"$:>$$> > "!'"'"! ! # (#%# 5 "5'5 %% 3;$33& $3;'$ "3."5"3$' "3;'!" 5 !3 '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # **""'"!() "'"! %%'' " *,*'$ "5' -+, '$ -.#/ &#012 "' 3+,&"4 "'"!56"!7$3 %+,& 8""+ %"$,&' %%5'9$ +,&8""+ %"$, &'' " %%5'9$ $:'6+$';'$"3 5 ""'"5$ "!% "5 3 $ 5$$$6" $6$5 " 3;+"$ ""$.'" ! & 8;+"$ "& 9$$67$ 3<=>$#"5:'"!"$: >$$> > "!'"'"! ;%% ! $%#&# ?" ?5$ : $6 ""'"! " ) "'"! %%'' " ""'% 5 %%" &?< . 3+,&"$63 '"!5 "'$' "%'" $$"'"!2 '$' " "!'"'"! 5 %%"$ ' : !"$ " $' "!'"'"! " ' $% %'$'7'' $ 5 "$5$' " , 6' $ 6 : $$ ' $ $6 '"5 3 " "!'"'"! :''"! %'$ "$'"! '"$ '5" !%"$ '$6 $6 '$ 3 $ 3 $6 "5'"! " %'"$""5 3 $6 , 7 3$ 3 " $ 56' $6 ,@ "57'%"$ / %# .# 0 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference:Consider approval of PD-273R2-C to establish a Detail Site Plan for a convenience store and gas pumps on 0.97 acres located at 890 S. Denton Tap Road. 2030: Business Prosperity Executive Summary: This request is to redevelop the site for a 2,991 square foot convenience store with a 3,096 square foot canopy over 6 gas pump islands. A deceleration lane is being provided along northbound Denton Tap and one driveway is being eliminated which will provide safer movements into this site. Introduction: The redevelopment of this corner property for a convenience store with gas pumps faces several challenges to adhere to the Commercial District and Landscaping requirements, however the redevelopment of this site will positively impact the aesthetics of this intersection and therefore is supported. To address the shortage in landscaped areas, the applicant is entering into a License Agreement with the city to allow landscaping (ground cover and seasonal color) and maintenance of the 1,237 square foot of city owned land at the corner of E. Belt Line and S. Denton Tap. Part of that approval would allow the monument sign to be placed at the property line, instead of 10 feet behind the property line which would be approximately 50 feet from the intersection. If this property is enhanced with ground cover and seasonal color, it could be used to fulfill the landscaping requirement which would achieve the 30% landscaping threshold. Rather than window signage, the applicant is requesting signage on the gas canopy. Specifically, three - 9 square foot, 7-ELEVEN full color logo medallions are proposed on the canopy. Notes have been added to the Site Plan to assure that the canopy lighting will be fully recessed, and compliance with the with the regulations on Outside Storage and Display in the Zoning Ordinance. Analysis: On October 12, 2018, the Planning and Zoning Commission unanimously recommended APPROVAL of PD-273R2-C, 7-Eleven, the following conditions remain outstanding: 1. Additional engineering comments will be generated upon detail engineering plan review. 2. A tree removal permit is required prior to construction. 2 3. This property shall be replatted prior to the issuance of any engineering or building permits. 4. Entering into a license agreement with the City of Coppell to allow for the landscaping and maintenance of the 1,237 square feet of land to achieve the 30% landscape requirement. Legal Review: This item did not require City Attorney review. Fiscal Impact: None Recommendation: The Planning Department recommended APPROVAL. Attachments: 1. Staff Report 2. Detailed Site Plan 3. Landscape Plan 4. Building Elevations 5. Sign Package (5 pages) ITEM # 5 Page 1 of 4 CITY OF COPPELL PLANNING DEPARTMENT STAFF REPORT PD-273R2-C, 7-Eleven P&Z HEARING DATE: October 18, 2018 C.C. HEARING DATE: November 13, 2018 STAFF REP.: Marcie Diamond, Assistant Director of Community Development/Planning LOCATION: 890 S. Denton Tap Road SIZE OF AREA: 0.97 acres of property CURRENT ZONING: PD-273R (Planned Development-273 Revised-Commercial) REQUEST: A zoning change request to PD-273R2-C (Planned Development-273 Revision 2- Commercial), to establish a Detail Site Plan for a convenience store and gas pumps. APPLICANT: Owner: Engineer: VP Fuel Mart, Inc Matt Moore, PE 890 S. Denton Tap Rd. Claymoore Engineering Coppell, Texas 75019 1903 Central Drive, Suite 406 972-983-2630 Bedford, Texas 76021 Email: psidhu.dallas@gmail.com (817) 281-0572 matt@claymooreeng.com HISTORY: This property was originally platted in 1984 for the development of the Mobil Gas Station. The brand changed from Mobil to Texaco in 2008 and the ownership changed in 2013 to First Global Group, Inc. In February 2015, Council approved a PD for this tract to allow the partial redevelopment of the existing gas station/car wash and convenience store site. The proposal included a 4,400-square-foot structure (3,200-square-foot convenience store/1,200-square-foot drive-thru restaurant) and the existing gas canopy to remain. Prior to approval the applicant purchased 8,161 square feet of recently abandoned right-of-way from the City to meet the minimum landscape requirement for this development. HISTORIC COMMENT: This property does not have any historic significance. ITEM # 5 Page 2 of 4 TRANSPORTATION: Denton Tap Road is a six-lane divided thoroughfare built to standard within a 120- foot right-of-way. East Belt Line is a four-lane divided thoroughfare that widens to six lanes at the intersection (allowing for a dual left turn) within a 120-foot right-of- way. 8,161 square-feet of the right-of-way on the northeast corner of the intersection was recently abandoned by the City and purchased by First Global Group. SURROUNDING LAND USE & ZONING: North: exit drive for Chicken Express; PD-232-C (Planned Development-232- Commercial) South: gas station; C (Commercial) East: Chicken Express Restaurant; PD-232-C (Planned Development-232- Commercial) West: Dairy Queen Restaurant; C (Commercial) COMPREHENSIVE PLAN: The Coppell 2030 Comprehensive Master Plan shows this property as suitable for Mixed Use Community Center (or single family residential), which includes neighborhood serving retail. DISCUSSION: As discussed above, a somewhat similar PD was approved on this site five years ago for a convenience store with drive through restaurant and the retention of the existing gas canopy, which was never constructed. The current request is to redevelop the entire site and build a new 2,991 square foot convenience store with a 3,096 square foot canopy over 6 gas pump islands. A deceleration lane is being provided for northbound Denton Tap as well as the elimination of one driveway along to provide for safer movements into this site. This redevelopment does face several challenges in meeting the Commercial District and Landscaping requirements, however the redevelopment of this site will positively impact the aesthetics of this intersection Site Plan: This site is just under an acre in size and abuts developed property. The convenience store is to be located in the northeastern corner of the site. The northern side yard setback is proposed to be 20 feet instead of the 30 feet required by ordinance. This is acceptable to staff, as directly to the north is a 30-foot wide property with an exit drive leading from Chicken Express to S. Denton Tap and no future buildings could be located on that property. There will be approximately 80 feet between the existing office building to the north and this proposed building (30’ setback north of the driveway + 30’ Chicken Express drive + 20’ proposed setback). The eastern rear yard setback is 20 feet, meeting the required 20 feet stated in the Zoning Ordinance. The gas canopy is allowed to encroach into the 60-foot building line and is proposed to be located 45 feet from S. Denton Tap R.O.W, and 38’ from the proposed curb line of the deceleration lane. There will be a 64-foot setback from E. Belt Line Road. A dumpster enclosure is proposed to be located 135 feet from E. Belt Line Road. ITEM # 5 Page 3 of 4 Parking: The parking required for a convenience store is one parking space per 200 square feet. The applicant is proposing to exceed the minimum 15 parking spaces required for 3,000-square-feet of convenience store by providing 20 spaces. Tree Survey/Landscape Plan: As mention above, this small corner site poses development challenges to adhere to the regulations of the Landscape Ordinance. A recent amendment to the ordinance provides for lots less than two acres, the landscape area is capped at 30%. For this site, that would be 12,553 square feet of landscaped area. Although the calculations are slightly in error on the Landscape Plan, it appears that they are providing in 11,893 in landscaped areas. There have been discussions with the applicant to consider entering into a License Agreement with the city to allow landscaping (ground cover and seasonal color) and maintenance of the 1,237 square foot of city owned land at the corner of E. Belt Line and S. Denton Tap. Part of that approval would allow the monument sign to be placed at the property line, instead of 10 feet behind the property line which would be approximately 50 feet from the intersection. If this property is enhanced with ground cover and seasonal color, it could be used to fulfill the landscaping requirement which would achieve the 30% landscaping threshold. Alternatively, up to five (5) of the parking spaces could be eliminated from this corner, to balance out this landscape requirement. Elevations/Signage The building will be a dark red brick building, with stone accents and a metal canopy over the front door. The attached signage will be limited to an 87.5 square foot,7-ELEVEN sign of white, individually mounted channel letters. The canopy will be a neutral (gray) metal, and its supports are clad with the same brick as the main building. Instead of window signage, the applicant is requesting signage on the gas canopy. Specifically, 9 square foot, 7-ELEVEN full color logo medallions are proposed on three sides. The materials and color the canopy over the gas pumps needs to be specified on the elevations. Also, a note needs to be added that “The canopy lighting shall be fully recessed so that no light fixture extends or is otherwise visible below the canopy as viewed from the adjacent public right-of- way”. Finally, a note specifying compliance with the with the regulations on Outside Storage and Display in Section 42 of the Zoning Ordinance is recommended to be added to the Site Plan. A 30-square-foot monument sign is proposed to be located on the southwest corner of the site. It is proposed to be constructed of the same brick as the building. The 7-ELEVEN logo will be halo lit and the and the gas prices will be on a scroller. Given the 1,237 square feet of city owned property separating this property to the actual intersection, staff in support of placing this sign adjacent to the property line, which will still be setback 40 feet from the curb line, assuming the license agreement is entered into. ITEM # 5 Page 4 of 4 RECOMMENDATION TO THE PLANNING AND ZONING COMMISSION: Staff is recommending APPROVAL of PD-273R2-C, subject to the following conditions being met: 1. Additional engineering comments will be generated upon detail engineering plan review. 2. A tree removal permit is required prior to construction. 3. This property shall be replatted prior to the issuance of any engineering or building permits 4. Correct the Landscape calculations, and include the license area, if applicable. 5. Depict 60’ front yard building setback line on site plan. 6. Fire lane shall be the full width of the driveway. 7. Specify the materials and color the canopy over the gas pumps needs on the elevations. 8. Either enter into a license agreement with the city of Coppell to allow for the landscaping and maintenance of the 1,237 square feet of land or revise the site plan to eliminate up to five (5) parking spaces to achieve the 30% landscape requirement. 9. Add the following PD Conditions: a. Three - 9 square foot, 7-ELEVEN full color logo medallions are permitted on the gas canopy. b. The canopy lighting shall be fully recessed so that no light fixture extends or is otherwise visible below the canopy as viewed from the adjacent public right-of-way c. This site shall comply with the regulations on Outside Storage and Display in Section 42 of the Zoning Ordinance. ALTERNATIVES: 1. Recommend approval of the request 2. Recommend disapproval of the request 3. Recommend modification of the request 4. Take under advisement for reconsideration at a later date ATTACHMENTS: 1. Aerial of Existing Buildings 2. Site Plan 3. Landscape Plan/Tree Survey 4. Building Elevations 5. Signage EX. TURN SIGNAL5'12'12'12'100' TURN LANE 50' TAPER 15' LANDSCAPESETBACK10' LANDSCAPESETBACK10' LANDSCAPE SETBACK ± EX. SIDEWALKEX. POWER POLE & ELECTRICEQUIPMENT TO BE RELOCATEDPROP. DUMPSTERENCLOSURE W/8' MASONRYENCLOSURE. REFER TOARCH. PLANS FOR DETAILS.PROP. B.F.R.PROP.UNDERGROUNDFUEL TANKSPROP.FUELCANOPYPROP. 2,991 SFCONVENIENCE STOREFFE=516.50PROP. STREET &PEDESTRIAN ESMT.PROP. FH119.9'44.92'53.14'±104.49' TO NEXT DRIVEWAYPROP. MONUMENT SIGNPROP. B.F.R.EX. MONUMENT SIGN63.65'PROP. B.F.R.30'30' 20' BUILIDNG LINE 20' BUILDING LINE24'FIRE LANE20.5'R30'R54'R50'R50'60' BUILDING LINE18'24'FIRE LANE10'36'40.98'18'34'24'R54'R30'9'TYP.9'TYP.86'18'12'8'15'20'20'83.33'28.01'28.01'158.13'R15'R74'R30'9' TYP.EX. SIDEWALKPROP. PAD MOUNTEDTRANSFORMER9'9'34'4.29'5'4.5'PROP.AIR/WATERSTATIONFUEL VENTS60' BUILDING LINER30'R25'R30'R10'DATENo. REVISION BYDATE:SHEETFile No. 2018-098CHECKED: MMDRAWN: JEVDESIGN: JEV7 ELEVEN890 S. DENTON TAP RD.COPPELL, TEXASTEXAS REGISTRATION #14199CLAYMOORE ENGINEERING1903 CENTRAL DRIVE, SUITE #406 PHONE: 817.281.0572BEDFORD, TX 76021 WWW.CLAYMOOREENG.COM10/31/2018BENCHMARK:1. A 60D NAIL SET ON NATURAL GROUND,APPROXIMATELY 13' EAST AND 14' SOUTH OF THENORTHEAST CORNER OF THE SUBJECT PROPERTY.ELEVATION=514.41'2. A 60D NAIL SET ON NATURAL GROUND,APPROXIMATELY 74' EAST AND 24' NORTH OF THENORTHWEST CORNER OF THE SUBJECT PROPERTY.ELEVATION=513.72'COUNTY:DALLAS COUNTYCITY: STATE:CITY OF COPPELL TEXASDEVELOPER:CITY OF COPPELLAPPLICANT:LEGAL DESCRIPTION:MOBIL SITE PLANVOL. 84110, PG. 2833,M.R.D.C.T.0.961 ACRES (41,843 SF)SHAFFER CONSTRUCTION2601 NETWORK BLVD, SUITE 413FRISCO, TEXAS 75034PH. 972.951.7851CLAYMOORE ENGINEERING, INC.1903 CENTRAL DR., SUITE #406BEDFORD, TX 76021PH: 817.281.0572SITE PLANCONTACT: MATT MOORE, PEEMAIL: MATT@CLAYMOOREENG.COMCONTACT: SHANE PARTRIDGEEMAIL:SPARTRIDGE@SCHAFFERCONST.COM7 ELEVENSITE PLANSP-1COUNTY:DALLAS COUNTYCITY: STATE:CITY OF COPPELL TEXASDEVELOPER:CITY OF COPPELLAPPLICANT:LEGAL DESCRIPTION:MOBIL SITE PLANVOL. 84110, PG. 2833,M.R.D.C.T.0.961 ACRES (41,843 SF)SHAFFER CONSTRUCTION2601 NETWORK BLVD, SUITE 413FRISCO, TEXAS 75034PH. 972.951.7851CLAYMOORE ENGINEERING, INC.1903 CENTRAL DR., SUITE #406BEDFORD, TX 76021PH: 817.281.0572SITE PLANCONTACT: MATT MOORE, PEEMAIL: MATT@CLAYMOOREENG.COMCONTACT: SHANE PARTRIDGEEMAIL:SPARTRIDGE@SCHAFFERCONST.COM7 ELEVEN0GRAPHIC SCALE1 inch = ft.20 20 402010N.T.S.VICINITY MAPLEGENDPROPOSED CONCRETE CURB AND GUTTERPARKING COUNTB.F.R. BARRIER FREE RAMPPROPOSED FIRE LANENORTH LAKES BELT LINE RDBETHEL SCHOOL RDW BETHEL RDE BELT LINE RDSITES DENTON TAP RDPD CONDITIONS1THREE - 9 SQUARE FOOT, 7-ELEVEN FULLCOLOR LOGO MEDALLIONS ARE PERMITTED ONTHE GAS CANOPY.2THE CANOPY LIGHTING SHALL BE FULLYRECESSED SO THAT NO LIGHT FIXTUREEXTENDS OR IS OTHERWISE VISIBLE BELOWTHE CANOPY AS VIEWED FROM THE ADJACENTPUBLIC RIGHT-OF-WAY.3THE SITE SHALL COMPLY WITH THEREGULATIONS OF OUTSIDE STORAGE ANDDISPLAY IN SECTION 42 OF THE ZONINGORDINANCE. SOSOSOSOCOCOCOCOCOLOLOLOCECECECECECOSOLOLOSODBDBDBDBCSCSCSDYDYDYDYNRNRNRNRNRNRNRNRNRNRNRNRNRNRNRNR1,237 SFcorner re int ined r NRNRNRNRNRABABABABABABABABABABABABABABABABABABABABABABABABABABABNRNRNRNRNRNRNRNRNRABABABABABABABNRNRNRNRNRNRNRNRNRNRNRNRBSBSBSBSGLGLGLGLGLGLDIHDIHDIHDIHPMPMPMPMPMPMPMCSCSCSDYDYDYBSBSCOBSBSBSBSBSBSBSBS12 SCCEH L-1LANDSCAPE PLAN& TREE SURVEY.UHNMOSAJETS TA3OF97ETXRFPY 0GRAPHIC SCALE1 inch = ft.TREE LEGENDC no Tree LOLi e O SOSh rd O COChin in O SHRUB LEGENDIn t ll 4" teel ed in et een ll hr ed nd r re .In t ll 4" l er of hredded h rd ood lch to ll l ntin ed .The ro ect ill h e n nder o nd to tic irri tion t e t o t e r l l n e l n t i n .LANDSCAPE NOTES1.2.3.4.Shr ed to h e 12 inche of re red l ntin i (75 i ort to oil, 15 co o ted end ent, 10 h e d n d )5.Shredded h rd ood lch t cont in lon tr nd lon ith do le hred finer teri l o t ined fro loc l o rce.6.In t ll 4 inche of cle n to oil in ll re of the ite di t r ed r din nd con tr ction o er tion . To oil h ll e freefro tic , de ri nd roc l r er th n 2 inche in di eter nd h e n or nic tter le el of 3 ercent ini nd H r n e et een 5.5 nd 7.4 ercent. Pro ide oil te t n l i fro oil te t l or tor ho in oil e ndor nic ercent e.7.Solid od ll re di t r ed con tr ction cti itie .CEChin in O 6030 303015E i tin tree E i tin treeto e re o edDATE:SHEETFile No. 2018-098CHECKED:MMDRAWN:JEVDESIGN: JEV7 ELEVEN890 S. DENTON TAP RD.COPPELL, TEXASTEXAS REGISTRATION #141991903 CENTRAL DRIVE, SUITE #406 PHONE: 817.281.0572BEDFORD, TX 76021 WWW.CLAYMOOREENG.COM11/01/2018COUNTY:DALLAS COUNTYCITY: STATE:CITY OF COPPELL TEXASDEVELOPER:CITY OF COPPELLAPPLICANT:LEGAL DESCRIPTION:MOBIL SITE PLANVOL. 84110, PG. 2833,M.R.D.C.T.0.961 ACRES (41,843 SF)SHAFFER CONSTRUCTION2601 NETWORK BLVD, SUITE 413FRISCO, TEXAS 75034PH. 972.951.7851CLAYMOORE ENGINEERING, INC.1903 CENTRAL DR., SUITE #406BEDFORD, TX 76021PH: 817.281.0572SITE PLANCONTACT: MATT MOORE, PEEMAIL: MATT@CLAYMOOREENG.COMCONTACT: SHANE PARTRIDGEEMAIL:SPARTRIDGE@SCHAFFERCONST.COM7 ELEVENTREE TABLE TAG #DIAMETER TYPE#4768" El #47712"Li e O #4788" El #4796" El #48018"O #4816" El *= removed tree**WATER BASINSHRUB PLANTINGSEE PLANTRIANGULARSPACINGSCALE: NONEEQUALMULTI-TRUNK PLANTINGPREPARE SOIL MIXAND FERTILIZERPER SPECS.TOP OF BALL ORROOT CROWN1" ABOVE FIN.STEEL EDGINGSEE PLANGRADEPLACING PREPARED MIXSCARIFY BOTTOM OFPLANTING BED BEFOREEQUALPREPARED SOIL MIXAND FERTILIZER (SEE SPECS)12"4" MULCH LAYERSCALE: NONE4"NATIVE SOIL4" MULCH LAYER4" MULCH LAYER12" DEPTH OFPLANTING MIXTRIANGULARSPACINGEQUALEQUALSCALE: NONEGROUNDCOVER PLANTING2348"DETAIL FORARBOR-GUYREFER TO ANCHORINGSTEEL EDGINGSEE PLANCANOPY TREE PLANTINGSCALE: NONE1TREE STAKE SOLUTIONS LLC9973 FM 521 ROADROSHARON, TX 77583PHONE: (281) 778-1400FAX: (281) 778-1425www.treestakesolutions.com™SolutionsUNDISTURBEDSOILNAILSTAKEROOT ANCHORU-BRACKETROOTBALLPLANTING HOLEUNDISTURBEDSOILROOT ANCHORU-BRACKETROOTBALLPLANTING HOLETREETREENAIL STAKEPLANTING HOLETREEU-BRACKETROOT ANCHORTREE TRUNKROOTBALL1. WITH TREE IN A STRAIGHT & PLUMBPOSITION, CENTER THE APPROPRIATE ROOTANCHOR SAFETY STAKE AROUND THE TRUNK,WITH RINGS LAYING FLAT AGAINSTROOTBALL, U-BRACKETS FACING UP.2. INSERT 1 OF 3 NAIL STAKES THROUGH EACH OFTHE U-BRACKETS. NAILS SHOULD REST IN THEUNDISTURBED SOIL AT THE BOTTOM OF THE TREEPIT. ALL NAILS SHOULD FIT SNUG AGAINST THE SIDEOF THE ROOTBALL.(FOR HAND OR MACHINE DUG TREES, IT MAY BENECESSARY TO PENETRATE 1" - 4" OF OUTER AREAOF THE ROOTBALL WITH THE NAIL.)3. NAIL STAKES SHOULD BE DRIVEN STRAIGHT DOWNINTO THE UNDISTURBED SOIL BELOW THEROOTBALL. THE NAILS ARE NOW CAGING THEROOTBALL IN PLACE, WHILE THE TOP BRACKET PINSTHE ROOTBALL DOWN.AFTER THE TREE STAKE IS INSTALLED, A LAYER OFMULCH CAN BE ADDED OVER THE STAKE. REMOVEROOT ANCHOR AFTER TREE IS ESTABLISHED.ITEM #5 BG15 BG30 BG45/65 BGDESCRIPTION5 GALLON OR 10" ROOTBALL10/15 GALLON OR 17" ROOTBALL20/30 GALLON OR 22" ROOTBALL45/65 GALLON OR 27-30" ROOTBALLNAIL LENGTH X 3PC(INCLUDED)#4 X 24"#4 X 36"#4 X 36"#4 X 48"ITEM #100 BG150 BG200 BG300 BGDESCRIPTION95/100 GALLON OR 36" ROOTBALL150 GALLON OR 42" ROOTBALL200 GALLON OR 48" ROOTBALL300 GALLON OR 58" ROOTBALLNAIL LENGTH X 3PC(INCLUDED)#5 X 48"#5 X 60"#5 X 72"#5 X 72"ROOT ANCHORTM BELOW GRADE SAFETY STAKE SIZING CHART3 l. 36" ocIle o itori 'N n 'D rf Y onChin in O Q erc hlen er iiDYCOSHRUBS & GROUNDCOVERS3 l. 36" ocS l i re ii 'Red'Red Cherr S eCSPLANT LISTCANOPY TREESA eli r ndiflor A eli AB10 l. 36" oc 30" hei htIle 'Nellie R Ste en 'Nellie R Ste en Holl NRCed r El Ul cr ifoli CE77634426Sh rd O Q erc h rdiiSOLi e O Q erc ir ini n LO3" c l. B&B 12' ht. 6' re d653 l. 36" ocLirio e i nte Gi nt Lirio eGL83 l. 36" ocM hlen er i c ill ri Pin M hl PM75 l. 36" ocIle corn t rfordi n n D rf B rford Holl DB410 l. 36" oc 30" hei ht5 l. 36" ocR hiole i indic 'Pin ie'D rf Ind. H thorneDIH41 l. 24" ocR d ec i hirt B l c e e d S nBS143" c l. B&B 12' ht. 6' re d3" c l. B&B 12' ht. 6' re d3" c l. B&B 12' ht. 6' re dD rf Y onDYRed Cherr S eCSA eli ABNellie R Ste en Holl NRGi nt Lirio eGLPin M hl PMD rf B rford Holl DBD rf Ind. H thorneDIHB l c e e d S nBSSe on l color l ntin ed er i n e licen e ree entSe on l ColorSC1 l. 24" ocTo e deter ined t ti e of l ntin Se on l ColorSC12LANDSCAPE CALCULATIONSCit of Co ell, Te L nd c e Are 30 Pro idedRe iredNon-Vehic l r L nd c e Are Tot l Lot Are 41,843 SFPro idedRe ired12,553 SF1 tree er 15 ce 2Pro idedRe iredInterior L nd c in 974 SF20 ce 1 tree t ter in of ro 0.9127 AC1 tree / 400 ftPro idedRe iredPeri eter L nd c in 41 tree / 50 line r ftNorth ro ert line 174.99 LF4So th ro ert line 157.57 LF10 re re ired l nd c etot l r in re 9,745 SF3 tree 983 SF2 r in tree 4 C no 4 C no Tree 1 tree / 2,500 ft3 tree 3 C no Tree 5E t ro ert line 249.8 LF5 C no Tree 5We t ro ert line 231.45 LF5 C no Tree Percent e of tot l ite de oted to l nd c in 3 tree 10 ft. idth15 ft. idth10 ft. idth15 ft. idth1,694 SF2,378 SF1,142 SF1,630 SF - 2,994 = 38,849 .15 = 5,827 SF5,827 SF50 l nd c e re in front rd2,914 SF4,066 SF13,130 SFPeri eter L nd c e Are 6,844 SFInterior L nd c e Are 983 SFNon-Vehic l r L nd c e Are 4,066 SFBelt LIne Rd.41,843 SFTree Miti tionRe o ed tree #47712" Li e O #480 18" O 30" tot l re o edMiti tion to e id into tree f nd(31.3 )13,130 SF(31.3 )M int ined r corner re 1,237 SF 720 720#+,*+3$5$3(7 %(0(5*(1&<(*5(66/,*+75($5&$123<'2:163287720$7&+&$123<7<32)35(),1,6+('0(7$/&$123<*$35(),16+('0(7$/3$5$3(7&$3:$//3$&.7<35()(/(&75,&$/:+,7(9,1</675((7$''5(66%%$&./,7)$6&,$6,*1%<6,*1$*(&2175$&7256,*1$*(81'(56(3(5$7(3(50,76716%67),1,6+75$16,7,21 %166767/,1(2)522)720 720#+,*+3$5$3(7 ),1,6+75$16,7,21 16%67(0(5*(1&<(*5(66/,*+7:$//3$&.5()(/(&75,&$/35(),1,6+('0(7$/&$123<72),1,6+)/225720 %%67&200(5&,$/*5$'(6($0/(666&833(5 '2:163287/$''(53257522)$&&(66(0(5*(1&<(*5(66/,*+7:$//3$&.5()(5(1&((/(&75,&$/372),1,6+)/225720 &200(5&,$/*5$'(6&833(5 '2:163287:$//3$&.5()(/(&75,&$/3%6772),1,6+)/225720 720#+,*+3$5$3(7 ),1,6+75$16,7,21 (0(5*(1&<(*5(66/,*+7:$//3$&.5()(5(1&((/(&75,&$/35(),1,6+('0(7$/&$123<676716%;66&$1(%2/7$7($&+*$7($/7(51$7(6,'(62)3$1(/66+$1'/(&8672008(//(585(7+$1(*$7(63(50$7(5,$/6&+('8/(6+((7$3$,17('33529,'(39&6/((9(6,1&21&5(7(7<3720 '80367(5(1&/6/$%5()&,9,/%*$&$3)/$6+,1**&6833/,('720 '80367(5(1&/6/$%5()&,9,/),1,6+75$16,7,21 %%2//$5'%1667)& % )& %)&WZK:dEhDZ͗Z>^d͗Zs/^/KE^$%&'d,^>E^/'EdhZWW>zKE>zdKd,KhDEddKt,/,d,zZ&&/yEtyWZ^^>z/^>/DEzZ^WKE^//>/dz&KZ>>Kd,ZW>E^͕^W/&/d/KE^͕^d/Dd^͕ZWKZd^KZKd,ZKhDEd^KZ/E^dZhDEd^Z>d/E'dKKZ/EdEdKh^&KZEzWZdKZWZd^K&d,WZK:d͘(ŽƉǇƌŝŐŚƚϮϬϭϴĂƚĞƐΘƐƐŽĐŝĂƚĞƐ͕ƌĐŚŝƚĞĐƚƐƌĂǁŝŶŐƐĂŶĚ^ƉĞĐŝĨŝĐĂƚŝŽŶƐĂƐŝŶƐƚƌƵŵĞŶƚƐŽĨƐĞƌǀŝĐĞĂƌĞĂŶĚƐŚĂůůƌĞŵĂŝŶƚŚĞƉƌŽƉĞƌƚǇŽĨƚŚĞƌĐŚŝƚĞĐƚ͘dŚĞǇĂƌĞŶŽƚƚŽďĞƵƐĞĚŽŶŽƚŚĞƌƉƌŽũĞĐƚƐŽƌĞǆƚĞŶƐŝŽŶƐƚŽƚŚŝƐƉƌŽũĞĐƚĞǆĐĞƉƚďǇĂŐƌĞĞŵĞŶƚŝŶǁƌŝƚŝŶŐĂŶĚǁŝƚŚĂƉƉƌŽƉƌŝĂƚĞĐŽŵƉĞŶƐĂƚŝŽŶƚŽƚŚĞƌĐŚŝƚĞĐƚ͘ŽŶƚƌĂĐƚŽƌŝƐƌĞƐƉŽŶƐŝďůĞĨŽƌĐŽŶĨŝƌŵŝŶŐĂŶĚĐŽƌƌĞůĂƚŝŶŐĚŝŵĞŶƐŝŽŶƐĂƚũŽďƐŝƚĞ͖ƚŚĞƌĐŚŝƚĞĐƚǁŝůůŶŽƚďĞƌĞƐƉŽŶƐŝďůĞĨŽƌĐŽŶƐƚƌƵĐƚŝŽŶŵĞĂŶƐ͕ŵĞƚŚŽĚƐ͕ƚĞĐŚŶŝƋƵĞƐ͕ƐĞƋƵĞŶĐĞƐŽƌƉƌŽĐĞĚƵƌĞƐ͕ŽƌĨŽƌƐĂĨĞƚǇƉƌĞĐĂƵƚŝŽŶƐĂŶĚƉƌŽŐƌĂŵƐŝŶĐŽŶŶĞĐƚŝŽŶǁŝƚŚƚŚĞƉƌŽũĞĐƚ͘ƌĐŚŝƚĞĐƚEĂŵĞͲdEEdϱϬϮ^t^dZd͕^h/dϮEdKEs/>>͕ZϳϮϳϭϮttt͘d^Z,/dd^͘KDd>͗ϰϳϵ͘ϲϯϯ͘ϴϭϲϱ^dKZη͗ƌĐŚŝƚĞĐƚEƵŵďĞƌͲ$%&'(KE^dZhd/KEDE'Z&ůŽƌŝĚĂĞƌƚŝĨŝĐĂƚĞŽĨƵƚŚŽƌŝƚǇηϮϲϬϬϯϲϬϮϭϬͬϮϱͬϮϬϭϴϴ͗ϭϴ͗ϰϭD͗ͰhƐĞƌƐͰ^ƚŝůů<ͰŽĐƵŵĞŶƚƐͰϭϴϭϱϵKWW>>dyͺͺZϭϲͺ<ĞǀŝŶͺ^ƚŝůů͘ƌǀƚϭϴϭϱϵSCHAFFER CONSTRUCTIONϭϬͬϭϲͬϮϬϭϴϳͲ>sE/E͘ϯϮϬϬ,<ZZzZK͕/Zs/E'͕dyϳϱϬϲϯ7-ELEVEN STOREϮϲϬϭEdtKZ<>s͕͘^d͘ϰϭϯ890 S. DENTON TAP RD.COPPELL, TX 75019ϭϬϰϯϱϰϳ&Z/^K͕dyϳϱϬϯϰZzED&h^dZϵϳϵϬϱZs/tKZ>sd/KE^RBEϭϬͬϭϲͬϮϬϭϴWZKdK͗ϬϰͬϯϬͬϮϬϭϴ^,&&ZKE^dZhd/KEϮϲϬϭEdtKZ<>s͕͘^d͘ϰϭϯ&Z/^K͕dyϳϱϬϯϰZϯͬϭϲΗсϭΖͲϬΗϮ>sd/KEͲ&ZKEdZϯͬϭϲΗсϭΖͲϬΗϭ>sd/KEͲZ/',d^/ZϯͬϭϲΗсϭΖͲϬΗϲ>sd/KEͲZ/',dZZZϯͬϭϲΗсϭΖͲϬΗϳ>sd/KEͲ>&dZZ^/ZϯͬϭϲΗсϭΖͲϬΗϯ>sd/KEͲ>&d^/(;7(5,250$7(5,$/66&+('8/(127$//0$7(5,$/6,16&+('8/($5(86('12 0$7(5,$/ 0$18)$&785(5 &2/25% %5,&. 0(5,',$1 902'8/$59(/285)& $&0)8(/&$123<)$6&,$ 5(<12%21' ($670$1:+,7(3<16 1$785$/6721( %/$&.621%5,&. $867,1+$11$635,1*6&+233('67 (;7(5,253$,17('678&&2 6+(5:,1:,//,$06 $(67+(7,&:+,7(6:3 (;7(5,25+0'2256)5$0(675$6+(1&/2685(*$7(*5$9(/*8$5'6$1'/,*+732/(66+(5:,1:,//,$06 6($/6.,16:3 (;7(5,25%2//$5'6 6+(5:,1:,//,$06 6($/6.,16:6 $/80,1806725()5217*/$=,1* .$:1((5 '$5.%521=(& 35(),1,6+('$/80,180&$123< 0$3(6/80,6+$'(&$123< %5$,167250%521=((1$0(/05 0(0%5$1(522),1* '852/$67 :+,7(ZϯͬϭϲΗсϭΖͲϬΗϭϬ&ZKEdhDW^dZE>͘>sd/KEZϯͬϭϲΗсϭΖͲϬΗϭϭ^/hDW^dZE>͘>sd/KEZϯͬϭϲΗсϭΖͲϬΗϴ&h>EKWzͲ>KE'ZϯͬϭϲΗсϭΖͲϬΗϵ&h>EKWz^,KZd12 '$7( '(6&5,37,21 4(%Ġ3)'.3Ġ/.Ġ4(%3%Ġ0!'%3Ġ(!6%Ġ"%%.Ġ$%3)'.%$4/Ġ-%%4Ġ/2Ġ%8#%%$Ġ!,,Ġ!00,)#!",%Ġ#/$%3Ġ/22%15)2%-%.43Ġ/&Ġ4(%Ġ.%# Ġ!.$Ġ/24(%ĠĠ&"#Ġ!.$Ġ/2Ġ4(%ĠĠ3&"#Ġ#$2ĠBB2##ĠAA$0-ĠAACUSTOMERĠAPPROVALDATE$ESIGNERĠMH0AGEĠ4()3Ġ$%3)'.Ġ)3Ġ&/2Ġ4(%Ġ3/,%Ġ0520/3%Ġ/&Ġ),,5342!4)/.ĠĠ#/.#%04Ġ$%3)'.Ġ4()3Ġ&),%Ġ)3Ġ./4Ġ4/Ġ"%Ġ53%$Ġ&/2Ġ02/$5#4)/.Ġ!.$/2Ġ&!"2)#!4)/.Ġ4()3Ġ$%3)'.Ġ)3Ġ4(%Ġ3/,%Ġ02/0%249Ġ/&Ġ(!2").'%2Ġ!.$Ġ-!9Ġ./4Ġ"%Ġ53%$Ġ/2Ġ$50,)#!4%$Ġ).Ġ!.9Ġ&/2-Ġ7)4(/54Ġ4(%Ġ%802%33Ġ72)44%.Ġ0%2-)33)/.Ġ/&Ġ(!2").'%236% 2&<#USTOMERS<Ġ%LEVEN<!RT<36% 2ĠCDRDATEĠĠDESCRIPTIONĠDESIGNERĠMHMHMHMHMHMHREV22222/RIGINALĠ#ONCEPT2EVISEDĠSIGNĠ"ĠLETTERĠHEIGHTĠĠCHANGEDĠTOĠSTANDARDĠCANOPY2EVISEDĠSIGNĠ!ĠTOĠNON ILLUMINATEDĠREVISEDĠFUELĠCANOPY2EVISEDĠTOĠ3%)ĠBRANDĠFUEL2EVISEDĠSIGNĠ!ĠSITEĠPLANĠĠBUILDINGĠELEVATIONS2EVISEDĠSIGNĠ!ĠREMOVEDĠWINDOWĠSIGNSĠFROMĠEXHIBIT %LEVENĠĠ3Ġ$ENTONĠ4APĠ2OAD#OPPELLĠ4EXASĠĠ3HADĠ2OADĠ*ACKSONVILLEĠ&,ĠĠoĠĠ/HIOĠ$RĠ0LANOĠ48ĠĠoĠ2%2ĠAA6LWH3ODQ´ %&&&$0RQXPHQW6LJQ$´&KDQQHO/HWWHUV%&:&DQRS\6LJQV 4(%Ġ3)'.3Ġ/.Ġ4(%3%Ġ0!'%3Ġ(!6%Ġ"%%.Ġ$%3)'.%$4/Ġ-%%4Ġ/2Ġ%8#%%$Ġ!,,Ġ!00,)#!",%Ġ#/$%3Ġ/22%15)2%-%.43Ġ/&Ġ4(%Ġ.%# Ġ!.$Ġ/24(%ĠĠ&"#Ġ!.$Ġ/2Ġ4(%ĠĠ3&"#Ġ#$2ĠBB2##ĠAA$0-ĠAACUSTOMERĠAPPROVALDATE$ESIGNERĠMH0AGEĠ4()3Ġ$%3)'.Ġ)3Ġ&/2Ġ4(%Ġ3/,%Ġ0520/3%Ġ/&Ġ),,5342!4)/.ĠĠ#/.#%04Ġ$%3)'.Ġ4()3Ġ&),%Ġ)3Ġ./4Ġ4/Ġ"%Ġ53%$Ġ&/2Ġ02/$5#4)/.Ġ!.$/2Ġ&!"2)#!4)/.Ġ4()3Ġ$%3)'.Ġ)3Ġ4(%Ġ3/,%Ġ02/0%249Ġ/&Ġ(!2").'%2Ġ!.$Ġ-!9Ġ./4Ġ"%Ġ53%$Ġ/2Ġ$50,)#!4%$Ġ).Ġ!.9Ġ&/2-Ġ7)4(/54Ġ4(%Ġ%802%33Ġ72)44%.Ġ0%2-)33)/.Ġ/&Ġ(!2").'%236% 2&<#USTOMERS<Ġ%LEVEN<!RT<36% 2ĠCDRDATEĠĠDESCRIPTIONĠDESIGNERĠMHMHMHMHMHMHREV22222/RIGINALĠ#ONCEPT2EVISEDĠSIGNĠ"ĠLETTERĠHEIGHTĠĠCHANGEDĠTOĠSTANDARDĠCANOPY2EVISEDĠSIGNĠ!ĠTOĠNON ILLUMINATEDĠREVISEDĠFUELĠCANOPY2EVISEDĠTOĠ3%)ĠBRANDĠFUEL2EVISEDĠSIGNĠ!ĠSITEĠPLANĠĠBUILDINGĠELEVATIONS2EVISEDĠSIGNĠ!ĠREMOVEDĠWINDOWĠSIGNSĠFROMĠEXHIBIT %LEVENĠĠ3Ġ$ENTONĠ4APĠ2OAD#OPPELLĠ4EXASĠĠ3HADĠ2OADĠ*ACKSONVILLEĠ&,ĠĠoĠĠ/HIOĠ$RĠ0LANOĠ48ĠĠoĠ2%2ĠAA0$18)$&785( 6+,321(0/')121,//80,1$7('6,*1&$%,1(7:,7+5(9(56(+$/2,//80,1$7('&+$11(//2*2)2506´'((3(;758'('$/80&$%,1(7:´,16(7+,1*('5(7$,1(5672%(3$,17(''85$12',&%521=(´,16(75(7$,1(5672%(+,1*('2121(6,'(2)&$%,1(7/2*2&+$11(/)2506´'((3$/80,1805(78516 $/80,180)$&(6:´7+,&.&/($532/<&$5%21$7(%$&.6)25063$,17('30625$1*(3065('306*5((15(785162))250663$,17('720$7&+)$&(&2/25³´72%(0*5((19,1</$33/,('),567685)$&(/(77(5672%(5(9(56(+$/2,//80,1$7('::+,7(/('6/(77(563,102817('´2))$/80,180&$%,1(7)$&(3$1(/7+$7,63$,17(''85$12',&%521=( 306:+,7(&86720/)$&(6´7+,&.3$1)250('&/($532/<&$5%21$7()$&(6%$&.635$<('3065('7+(1306:+,7(352326(':,7+3:0´121,//80,1$7('6(*0(17(/(&7521,&35,&(81,760*5((19,1</63(&6'85$12',&%521=(30625$1*(3065('306*5((1306:+,7(3$,1763(&6127(02180(176,*16+$//%(&216758&7('2)7+(6$0(35,0$5<0$6215<0$7(5,$/6$67+()5217%8,/',1*)$&$'(257+(35,1&,3$/250$,1%8,/',1*217+(6$0(/27256+$//%(6721(25%5,&.$1'6+$//%(6,0,/$5$5&+,7(&785$/67</(127($//%5,&.0$6215<72%(3529,'('%<*&¶668%&2175$&725)URQW(OHYDWLRQ 6LGH'HWDLO&XVWRP0RQXPHQW6LJQ6WUXFWXUH6LJQ$´ ¶´'LVSOD\6TXDUH)RRWDJH&DELQHW¶´´2$+´´2$:´´&+$11(/)250´3$1´92´&876,=(´5(7$,1(5´&$%,1(7)$&(0675((76,'(2$+2$/´´(/(9(1/2*2',0(16,216+,1*(´,16(75(7$,1(53$11('´32/<)$&(´3$1´3$1´0$6215<%$6(%<*&68%3:035,&(6&52//(53:035,&(6&52//(5127(*$635,&(&$%,1(772%((;7(51$//<,//80,1$7('127($//$1<(;7(51$/,//80,1$7,21,672%(3529,'('%<(/(&75,&$/&2175$&725127(7<3(2)(;7(51$//,*+7,1*,67%'$OORZHG3URSRVHGVTIWVTIW7RWDO6LJQ6TXDUHIRRWDJH&DOFXODWLRQV$OORZHG3URSRVHG)HHW)HHW2YHUDOO+HLJKW5HTXLUHPHQWV3URSRVHG)HHW)HHW6HW%DFNV(OHFWURPDJQHWLFWHFKQRORJ\LQYROYHVFKDQJLQJDPDJQHWLFILHOGVRDVWRLQGXFHDQHOHFWULFFXUUHQW$QHOHFWURPDJQHWLFILHOGFRQYHUWVWKHPHFKDQLFDOHQHUJ\LQWRHOHFWULFDOHQHUJ\3:0XVHVWKLVWHFKQRORJ\IRUWKHLUVHJPHQWVLJQV3RZHULVRQO\UHTXLUHGWRFKDQJHWKHGDWDGLVSOD\HG,QKHUHQWPDJQHWLFPHPRU\LQHDFKVHJPHQWUHWDLQVWKHGLVSOD\LQGHILQLWHO\ZLWKRXWSRZHUEHLQJDSSOLHG7KHGDWDRQPXOWLSOHGLVSOD\VFDQEHTXLFNO\FKDQJHG7KHOLJKWUHIOHFWLQJVHJPHQWVSURYLGHH[FHOOHQWYLVLELOLW\IRUDZLGHUDQJHRIDPELHQWOLJKWFRQGLWLRQV9LVLELOLW\LQFUHDVHVZLWKDQLQFUHDVHLQWKHDPELHQWOLJKWOHYHO&KDUDFWHUVDUHYLVLEOHIURPYHU\ZLGHDQJOHV(DFKVHJPHQWURWDWHVRQDVWDLQOHVVVWHHOSLYRWIRUPD[LPXPUHOLDELOLW\+HDWLVDQRQLVVXHIRUHOHFWURPDJQHWLFVLJQV,QDUHDVZKHUHVHJPHQWVLJQVDUHH[SRVHGWRH[WUHPHFROGDGGLWLRQDOKHDWLQJLVUHTXLUHG3ULQFLSOHVRI2SHUDWLRQ7KHGUDZLQJV/()7VKRZDURXQGHGSDQHOVHJPHQWIURPWKHWRSYLHZ7RVHWDSULFHPHDQLQJWRDGMXVWWKHVHJPHQWVWRUHIOHFWWKHGHVLUHGQXPEHUDQHOHFWURQLFLPSXOVHWRWKHFRLOFUHDWHVDPDJQHWLFILHOG7KLVPDJQHWLFILHOGWXUQVWKHVHJPHQWLQRURXW(DFKVHJPHQWPRYHVEHWZHHQWKHEDFNJURXQGDQGGLVSOD\VXUIDFHSODWH3:06(*0(17(/(&7521,&35,&(81,71 ´&+$11(/)250´&$%,1(7´3$1 ´92 ´&876,=(´´´´´´´0$6215<%$6(%<*&68%´ ´9:$775(027(32:(56833/<´$/803$,17(')$&(´&/($532/<&$5%21$7(:+,7(/('6$/805(78516´67$1'2))$/80%$&.3$1(/1 1,*+79,(:1,*+79,(:´ 4(%Ġ3)'.3Ġ/.Ġ4(%3%Ġ0!'%3Ġ(!6%Ġ"%%.Ġ$%3)'.%$4/Ġ-%%4Ġ/2Ġ%8#%%$Ġ!,,Ġ!00,)#!",%Ġ#/$%3Ġ/22%15)2%-%.43Ġ/&Ġ4(%Ġ.%# Ġ!.$Ġ/24(%ĠĠ&"#Ġ!.$Ġ/2Ġ4(%ĠĠ3&"#Ġ#$2ĠBB2##ĠAA$0-ĠAACUSTOMERĠAPPROVALDATE$ESIGNERĠMH0AGEĠ4()3Ġ$%3)'.Ġ)3Ġ&/2Ġ4(%Ġ3/,%Ġ0520/3%Ġ/&Ġ),,5342!4)/.ĠĠ#/.#%04Ġ$%3)'.Ġ4()3Ġ&),%Ġ)3Ġ./4Ġ4/Ġ"%Ġ53%$Ġ&/2Ġ02/$5#4)/.Ġ!.$/2Ġ&!"2)#!4)/.Ġ4()3Ġ$%3)'.Ġ)3Ġ4(%Ġ3/,%Ġ02/0%249Ġ/&Ġ(!2").'%2Ġ!.$Ġ-!9Ġ./4Ġ"%Ġ53%$Ġ/2Ġ$50,)#!4%$Ġ).Ġ!.9Ġ&/2-Ġ7)4(/54Ġ4(%Ġ%802%33Ġ72)44%.Ġ0%2-)33)/.Ġ/&Ġ(!2").'%236% 2&<#USTOMERS<Ġ%LEVEN<!RT<36% 2ĠCDRDATEĠĠDESCRIPTIONĠDESIGNERĠMHMHMHMHMHMHREV22222/RIGINALĠ#ONCEPT2EVISEDĠSIGNĠ"ĠLETTERĠHEIGHTĠĠCHANGEDĠTOĠSTANDARDĠCANOPY2EVISEDĠSIGNĠ!ĠTOĠNON ILLUMINATEDĠREVISEDĠFUELĠCANOPY2EVISEDĠTOĠ3%)ĠBRANDĠFUEL2EVISEDĠSIGNĠ!ĠSITEĠPLANĠĠBUILDINGĠELEVATIONS2EVISEDĠSIGNĠ!ĠREMOVEDĠWINDOWĠSIGNSĠFROMĠEXHIBIT %LEVENĠĠ3Ġ$ENTONĠ4APĠ2OAD#OPPELLĠ4EXASĠĠ3HADĠ2OADĠ*ACKSONVILLEĠ&,ĠĠoĠĠ/HIOĠ$RĠ0LANOĠ48ĠĠoĠ2%2ĠAA¶´2$:¶´2$+0$18)$&785( 6+,321(6(72)&86720´/(77(5+(,*+7,17(51$//<,//80,1$7('5(027(&+$11(//(77(56´7+,&.:+,7($&5</,&)$&(6´'((3$/80,1805(7851635(3$,17(''85$12',&%521=(´'85$12',&%521=(-(:(/,7(75,0&$3/(77(5672%(,17(51$//<,//80,1$7('::+,7(/('6'85$12',&%521=(3$,1763(&6127(/2*26,1$1<&2/256+$//127(;&(('2)7+($5($2)7+(6,*1)URQW9LHZ 6LGH0RXQWLQJ'HWDLO&XVWRP´/HWWHU+HLJKW,QWHUQDOO\,OOXPLQDWHG5HPRWH&KDQQHO/HWWHUV6LJQ%´ 'LVSOD\6TXDUH)RRWDJH´$/805(785169:$775(027(32:(56833/<00$&0:+,7(%$&.6´:+,7(32/<)$&(´-(:(/,7(75,0&$3:+,7(/('6%8,/',1*:$//´$//7+5($':1876 :$6+(5ò´6($/7,7(&21'8,7´:((3+2/(6',6&211(&76:,7&+',6&211(&76:,7&+,16,'(:$// 4(%Ġ3)'.3Ġ/.Ġ4(%3%Ġ0!'%3Ġ(!6%Ġ"%%.Ġ$%3)'.%$4/Ġ-%%4Ġ/2Ġ%8#%%$Ġ!,,Ġ!00,)#!",%Ġ#/$%3Ġ/22%15)2%-%.43Ġ/&Ġ4(%Ġ.%# Ġ!.$Ġ/24(%ĠĠ&"#Ġ!.$Ġ/2Ġ4(%ĠĠ3&"#Ġ#$2ĠBB2##ĠAA$0-ĠAACUSTOMERĠAPPROVALDATE$ESIGNERĠMH0AGEĠ4()3Ġ$%3)'.Ġ)3Ġ&/2Ġ4(%Ġ3/,%Ġ0520/3%Ġ/&Ġ),,5342!4)/.ĠĠ#/.#%04Ġ$%3)'.Ġ4()3Ġ&),%Ġ)3Ġ./4Ġ4/Ġ"%Ġ53%$Ġ&/2Ġ02/$5#4)/.Ġ!.$/2Ġ&!"2)#!4)/.Ġ4()3Ġ$%3)'.Ġ)3Ġ4(%Ġ3/,%Ġ02/0%249Ġ/&Ġ(!2").'%2Ġ!.$Ġ-!9Ġ./4Ġ"%Ġ53%$Ġ/2Ġ$50,)#!4%$Ġ).Ġ!.9Ġ&/2-Ġ7)4(/54Ġ4(%Ġ%802%33Ġ72)44%.Ġ0%2-)33)/.Ġ/&Ġ(!2").'%236% 2&<#USTOMERS<Ġ%LEVEN<!RT<36% 2ĠCDRDATEĠĠDESCRIPTIONĠDESIGNERĠMHMHMHMHMHMHREV22222/RIGINALĠ#ONCEPT2EVISEDĠSIGNĠ"ĠLETTERĠHEIGHTĠĠCHANGEDĠTOĠSTANDARDĠCANOPY2EVISEDĠSIGNĠ!ĠTOĠNON ILLUMINATEDĠREVISEDĠFUELĠCANOPY2EVISEDĠTOĠ3%)ĠBRANDĠFUEL2EVISEDĠSIGNĠ!ĠSITEĠPLANĠĠBUILDINGĠELEVATIONS2EVISEDĠSIGNĠ!ĠREMOVEDĠWINDOWĠSIGNSĠFROMĠEXHIBIT %LEVENĠĠ3Ġ$ENTONĠ4APĠ2OAD#OPPELLĠ4EXASĠĠ3HADĠ2OADĠ*ACKSONVILLEĠ&,ĠĠoĠĠ/HIOĠ$RĠ0LANOĠ48ĠĠoĠ2%2ĠAA¶%8,/',1*:,'7+¶¶6WRUHIURQW 6LGH&RUQHU(OHYDWLRQ6LJQ%´ ¶´6TXDUHIRRWDJH&DOFXODWLRQV$OORZHG3URSRVHGVTIWVTIW 4(%Ġ3)'.3Ġ/.Ġ4(%3%Ġ0!'%3Ġ(!6%Ġ"%%.Ġ$%3)'.%$4/Ġ-%%4Ġ/2Ġ%8#%%$Ġ!,,Ġ!00,)#!",%Ġ#/$%3Ġ/22%15)2%-%.43Ġ/&Ġ4(%Ġ.%# Ġ!.$Ġ/24(%ĠĠ&"#Ġ!.$Ġ/2Ġ4(%ĠĠ3&"#Ġ#$2ĠBB2##ĠAA$0-ĠAACUSTOMERĠAPPROVALDATE$ESIGNERĠMH0AGEĠ4()3Ġ$%3)'.Ġ)3Ġ&/2Ġ4(%Ġ3/,%Ġ0520/3%Ġ/&Ġ),,5342!4)/.ĠĠ#/.#%04Ġ$%3)'.Ġ4()3Ġ&),%Ġ)3Ġ./4Ġ4/Ġ"%Ġ53%$Ġ&/2Ġ02/$5#4)/.Ġ!.$/2Ġ&!"2)#!4)/.Ġ4()3Ġ$%3)'.Ġ)3Ġ4(%Ġ3/,%Ġ02/0%249Ġ/&Ġ(!2").'%2Ġ!.$Ġ-!9Ġ./4Ġ"%Ġ53%$Ġ/2Ġ$50,)#!4%$Ġ).Ġ!.9Ġ&/2-Ġ7)4(/54Ġ4(%Ġ%802%33Ġ72)44%.Ġ0%2-)33)/.Ġ/&Ġ(!2").'%236% 2&<#USTOMERS<Ġ%LEVEN<!RT<36% 2ĠCDRDATEĠĠDESCRIPTIONĠDESIGNERĠMHMHMHMHMHMHREV22222/RIGINALĠ#ONCEPT2EVISEDĠSIGNĠ"ĠLETTERĠHEIGHTĠĠCHANGEDĠTOĠSTANDARDĠCANOPY2EVISEDĠSIGNĠ!ĠTOĠNON ILLUMINATEDĠREVISEDĠFUELĠCANOPY2EVISEDĠTOĠ3%)ĠBRANDĠFUEL2EVISEDĠSIGNĠ!ĠSITEĠPLANĠĠBUILDINGĠELEVATIONS2EVISEDĠSIGNĠ!ĠREMOVEDĠWINDOWĠSIGNSĠFROMĠEXHIBIT %LEVENĠĠ3Ġ$ENTONĠ4APĠ2OAD#OPPELLĠ4EXASĠĠ3HADĠ2OADĠ*ACKSONVILLEĠ&,ĠĠoĠĠ/HIOĠ$RĠ0LANOĠ48ĠĠoĠ2%2ĠAA9$5,(6)URQW(OHYDWLRQ&DQRS\+HLJKW6LJQ$QG*UDSKLFV/D\RXW´ ¶´)DFH 6LGH'HWDLO:&DQRS\6LJQ&DELQHW6LJQ&ò´ ¶'LVSOD\6TXDUH)RRWDJH&DELQHW0$18)$&785( 6+,37+5((:6),17(51$//<,//80,1$7('&$123<6,*1&$%,1(76´7+,&.3$1)250(' (0%266(':+,7($&5</,&)$&(:75$16/8&(179,1</*5$3+,&6$33/,('),567685)$&(´'((3(;758'('$/80&$%,1(7:´5(7$,1(5672%(3$,17(':+,7(&$%,1(772%(,17(51$//<,//80,1$7('::+,7(/('69,1</63(&6025$1*(05('0*5((1306:+,7(3$,1763(&6127(6,*172%(,167$//('¶´)520/()7('*(2)*$6&$123<2$+2$/´´(/(9(1/2*2',0(16,2163$11('´$&5</,&)$&(212))72**/(6:,7&+/$*%2/76:6+,(/'6:+,7(/('*$6&$123<´´3$1´(0%266(0%266´(0%266$/80%$&.32:(56833/<´5(7$,1(5´&$%,1(7´&876,=(´92´3$1´&$%,1(7´&876,=(´92´3$1´)/$1*(´)/$1*()URQWDQG6LGH(OHYDWLRQ03'6WDFNHG&DQRS\&RQILJXUDWLRQ6LJQ&176¶´2$+¶´¶´¶´¶´¶´¶´¶´¶´)5217(/(9$7,216,'((/(9$7,216,'((/(9$7,21127(3(5&,7<&2'(75,675,3(6$5(127$//2:('¶´2$+¶´¶´5($5(/(9$7,21 ! !""# $%"& "# $#% # # !' "#! (( & # '%# ) '* !"'+ ', +" !""# ()*+ ,-'$. "! -" !""#!%"'!"%) '* !"'+ ', .. &!"'/"'0 ") "'' 1#'! "2 -'* ' & /"'"$3'/"'$#'"'* !4!"%'*5 ' !%" ! # -#%# ) '* !"'+ ', +" !""# 5/ -) '* !"'+ ', 3!#+!"% ) '!#-) '* !"'+ ', !""#- '%/# -#%# ,#0 #% -%1 , +01 '%# $ $# !# '%#0 *& " # (2(!' "#! +01 !' ()*+ ,-'$. "! -" !""#!%"'!"%) '* !"'+ ', ..&!"'/"' 0 ") "'' 1#'! "2 -'* '& /"'"$3'/"' $#'"'* !4!"%'*5 ' !%" 1// *3!#+!"%) '!# 3!*!"'* "6!) /3 *3!#*!"%!- '*!%"'! " -!"'/"'4 "- ) '* !"'+ ' , .. '#!3. '&&"&2 # -'*) '* !"'$!'! " 2#'#' -" #' '* -) '* !"'7!" ' -1& ." % % ! ! $%#&# # " /!#7 /"'# //" . %# *# ( 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference: Consider approval of an Ordinance designating Northpoint Hotel Group, LLC, Reinvestment Zone No. 102 pursuant to Section 312.201 of the Property Redevelopment and Tax Abatement Act, and authorizing the Mayor to sign. 2030: Business Prosperity Executive Summary: Northpoint Hotel Group, LLC is constructing two hotels with meeting space on 5.253 acres of land south of Northpoint Drive and west of S. Royal Lane. Reinvestment Zone No. 102 is being created for this property. Introduction: Northpoint Hotel Group, LLC is constructing two select service hotels with meeting space. The Aloft Hotel will consist of 140 guest rooms and 4,000 square feet of meeting space. The hotel will be 77,800 square feet in size and will be located at 1155 Northpoint Drive. Holiday Inn Express will contain of 125 guest rooms and 1,200 square feet of meeting space. This hotel will be 69,600 square feet in size and will be located at 1125 Northpoint Drive. In order to grant a tax abatement, a reinvestment zone must be created by ordinance. In order to create a reinvestment zone by ordinance, a public hearing must be held. This item satisfies both of those requirements. The public hearing is held to determine if the improvements in the zone are feasible, practical and of benefit to the land. The ordinance will create Reinvestment Zone No. 102. Analysis: The Public Hearing Notice was published in the Citizens’ Advocate on Friday, November 2, 2018. The reinvestment zone is being created for Northpoint Hotel Group, LLC. The legal description for the property to be included in the reinvestment zone is described as Lots 1R2R and 1R3, Block 1 of the Northpoint Addition, a 5.253-acre tract of land. The land is located south of Northpoint Drive 2 and west of S. Royal Lane. Legal Review: The documents were created by Pete Smith. Fiscal Impact: N/A Recommendation: Community Development recommends approval. NOTICE OF PUBLIC HEARING OF DESIGNATION OF REINVESTMENT ZONE A PUBLIC HEARING will be conducted by the City Council of the City of Coppell, Texas, in the Council Chambers, Town Center, 255 Parkway Boulevard, Coppell, Texas on the 13th day of November, 2018, at 7:30 P.M., to consider designation of the property described as Lots 1R2R and 1R3, Block 1 of the Northpoint Addition (5.253 acres), located south of Northpoint Drive and west of S. Royal Lane, Coppell, Texas, Northpoint Hotel Group, LLC as a Reinvestment Zone under Chapter 312 of the Texas Property Tax Code. The Council will seek to determine whether the improvements sought to be made in the zone are feasible and practical and will be a benefit to the land included in the zone and to the City after the expiration of a tax abatement agreement to be entered into pursuant to Section 312.204 of the Texas Property Tax Code. At the hearing, interested persons are entitled to speak and present evidence for or against the designation. Citizens’ Advocate November 2, 2018 PUBLIC NOTICE STATEMENT FOR ADA COMPLIANCE & OPEN CARRY LEGISLATION The City of Coppell acknowledges its responsibility to comply with the Americans With Disabilities Act of 1990. Thus, in order to assist individuals with disabilities who require special services (i.e. sign interpretative services, alternative audio/visual devices, and amanuenses) for participation in or access to the City of Coppell sponsored public programs, services and/or meetings, the City requests that individuals make requests for these services forty-eight (48) hours ahead of the scheduled program, service, and/or meeting. To make arrangements, contact Kori Konnon, ADA Coordinator or other designated official at (972) 462-0022, or (TDD 1-800-RELAY, TX 1-800-735-2989). Pursuant to Section 30.06, Penal Code (trespass by license holder with a concealed handgun), a person licensed under Subchapter H, Chapter 411, Government Code (handgun licensing law), may not enter this property with a concealed handgun. Pursuant to Section 30.07, Penal Code (trespass by license holder with an openly carried handgun), a person licensed under Subchapter H, Chapter 411, Government Code (handgun licensing law), may not enter this property with a handgun that is carried openly. AN ORDINANCE OF THE CITY OF COPPELL, TEXAS ORDINANCE NO.__________ AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF COPPELL, TEXAS, DESIGNATING REINVESTMENT ZONE NO. 102 (NORTHPOINT HOTEL GROUP, LLC); PROVIDING ELIGIBILITY OF THE ZONE FOR COMMERCIAL-INDUSTRIAL TAX ABATEMENT; CONTAINING FINDINGS THAT THE AREA QUALIFIES TO BE DESIGNATED AS A REINVESTMENT ZONE AND THE IMPROVEMENTS SOUGHT ARE FEASIBLE AND PRACTICABLE AND OF BENEFIT TO THE LAND AND THE CITY; PROVIDING A SEVERABILITY CLAUSE; PROVIDING A REPEALING CLAUSE; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City Council of the City of Coppell, Texas, has caused notice to be published in a newspaper having general circulation in the City and has delivered such notice to the presiding officer of the governing body of each taxing unit that includes in its boundaries real property described herein; and, WHEREAS, the City Council of the City of Coppell, Texas, has conducted a public hearing on the designation of the area described herein as a reinvestment zone; and, NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF COPPELL, DALLAS COUNTY, TEXAS, THAT: SECTION 1. The City Council of the City of Coppell, Texas, finds that the area described herein will, if designated as a reinvestment zone, be reasonably likely to contribute to the retention or expansion of primary employment, or to attract major investment in the zone that will be of benefit to the property and contribute to the economic development of the City. The City Council further finds that the improvements sought are feasible and practicable and would be of benefit to the land to be included in the zone and to the City after the expiration of a tax abatement agreement. SECTION 2. Pursuant to the provisions of Section 312.201 of the Texas Tax Code, the real property described in Exhibit “A” and made a part hereof for all purposes is hereby designated as a reinvestment zone and for identification is assigned the name “Reinvestment Zone No. 102 Northpoint Hotel Group, LLC.” SECTION 3. The property within Reinvestment Zone No. 102 is eligible for commercial- industrial tax abatement effective on January 1, 2018. SECTION 4. If any article, paragraph or subdivision, clause or provision of this Ordinance shall be adjudged invalid or held unconstitutional, the same shall not affect the validity of this Ordinance as a whole or any part or provision thereof, other than the part so decided to be invalid or unconstitutional. SECTION 5. All provisions of ordinances of the City of Coppell, Texas, in conflict with the provisions of this Ordinance be, and the same are hereby, repealed, and all other provisions not in conflict with the provisions of this Ordinance shall remain in full force and effect. SECTION 6. This Ordinance shall take effect immediately from and after its passage, as the law and charter in such cases provide. DULY PASSED by the City Council of the City of Coppell, Texas, on the ________ day of _______________, 2018. APPROVED: _________________________________________ KAREN SELBO HUNT, MAYOR ATTEST: _________________________________________ CHRISTEL PETTINOS, CITY SECRETARY APPROVED AS TO FORM: _______________________________ CITY ATTORNEY Exhibit “A” (Legal Description of Land) Lots 1R2R and 1R3, Block 1 of the Northpoint Addition (5.253 acres) ! !" # $%# "# $#% # # "! #&" '' & # '%# ( !) "#!* !+ !" #$ ,!# * "-## #" ,! !" # "#%! $.!/#! $%/#!.! #!)"! , #( !) "#!* !+ 00 #!) "1"#%!)2 ! "%# ! # (#%# ( !) "#!* !+ !" #2/ $ ,!# * "-##,( !) "#!* !+ !" #$ ,!,$.!/#!$%/#! $ ,!,( !) "#!* !+ !" #* " -##,$.!/#!* "-## , '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # '3'"! #&" -+, "! #" ,! !" # "#%! $.!/#!$%/#!.! #!) "! , #( !) "#!* !+ 00#!) "1"#%!)2 ! "%# 4// "! #&" ) ."& *"#% %"#% !) "%#!" # , "#!/#! 5 # ( # ( /. 3 ( !) "#! * ! + " & #!&!"#% ! ) ! "# "#!/#! 5 # ( ) $.!/#! $%/#! , * " -## &! ! ( !) "#! 6" # $ ,! * ! &! ! ( !) "#! 6" * " -## & #!"# ! / # 7 ,! , /!"#% & "# 887 , ! .""#% ) $ ,! * ! " & #!"# %! / # 7 ,! , /!"#% & "# 7 , !.""#% &) $.!/#! $%/#! " , " , ) ! # ."# # ! , &) .""#% " &" 9 .!/#! , # 9.!/#!, 8# % % :#!;"&-/&!4!!/#!*< ! $%#&# //#"!6 /#!& //# / %# .# 0 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference: Consider approval of two Resolutions approving two Tax Abatement Agreements between the City of Coppell and Northpoint Hotel Group, LLC, and authorizing the Mayor to sign. 2030: Business Prosperity Executive Summary: Northpoint Hotel Group, LLC is constructing a select service hotel with meeting space at 1125 Northpoint Drive and a select service hotel with meeting space at 1155 Northpoint Drive. The tax abatement for each facility will be a 7-year agreement with 75% of the real and business personal property being abated for years 1 - 5 and 50% being abated for years 6 and 7. Introduction: Northpoint Hotel Group, LLC is constructing two select service hotels with meeting space that will be located south of Northpoint Drive and west of S. Royal Lane. Aloft Hotel will be located at 1155 Northpoint Drive. It will be a 77,800 square foot building that contains 140 guest rooms and 4,000 square feet of meeting space. Holiday Inn Express will be located at 1125 Northpoint Drive. It will be a 69,600 square foot building that contains 125 guest rooms and 1,200 square feet of meeting space. City Council will hold a Public Hearing regarding the designation of Reinvestment Zone No. 102 on November 13, 2018. Analysis: The tax abatement for each facility will be a 7-year agreement with 75% of the real and business personal property being abated for years 1 - 5 and 50% being abated for years 6 and 7. Legal Review: The documents were prepared by Pete Smith. Fiscal Impact: N/A 2 Recommendation: Community Development recommends approval. 1 RESOLUTION NO. ________________ A RESOLUTION OF THE CITY OF COPPELL, TEXAS, APPROVING THE TERMS AND CONDITIONS OF A TAX ABATEMENT AGREEMENT BY AND BETWEEN THE CITY OF COPPELL, TEXAS, AND NORTHPOINT HOTEL GROUP, LLC; AUTHORIZING ITS EXECUTION BY THE MAYOR; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City Council has been presented a proposed Tax Abatement Agreement by and between the City of Coppell, Texas, and Northpoint Hotel Group, LLC, a copy of which is attached hereto and incorporated herein by reference; and WHEREAS, upon full review and consideration of the Agreement, and all matters related thereto, the City Council is of the opinion and finds that the terms and conditions thereof should be approved, and that the Mayor should be authorized to execute the Agreement on behalf of the City of Coppell, Texas; NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF COPPELL, TEXAS, THAT: SECTION 1. The Agreement attached hereto having been reviewed by the City Council of the City of Coppell, Texas, and found to be acceptable and in the best interest of the City and its citizens, be, and the same is hereby, in all things approved, and the Mayor is hereby authorized to execute the Agreement on behalf of the City of Coppell, Texas. SECTION 2. The Council finds that the improvements proposed to be built upon the Premises described in the Agreement will enhance the economic vitality of the community through a combination of new capital investment, increased sales tax revenues, and the creation of additional job opportunities. SECTION 3. The improvements proposed for the Premises will accomplish the tax abatement guidelines of the City of Coppell, Texas. SECTION 4. The City Manager delivered to the presiding officer of the governing body of each taxing unit in which the property subject to the Agreement is located, a written notice 2 that the City of Coppell, Texas, intends to enter into the Agreement. The notice given by the City Manager included a copy of the Agreement approved by this Resolution. SECTION 5. This Resolution and the Tax Abatement Agreement are hereby approved by the affirmative vote of the majority of the members of the City Council of the City of Coppell, Texas, at a regularly scheduled meeting of the City Council. SECTION 6. This Resolution shall become effective immediately from and after its passage. DULY RESOLVED AND ADOPTED by the City Council of the City of Coppell, Texas, on this the ______ day of ________________, 2018. CITY OF COPPELL, TEXAS ___________________________________________ KAREN SELBO HUNT, MAYOR ATTEST: ___________________________________________ CHRISTEL PETTINOS, CITY SECRETARY APPROVED AS TO FORM: CITY ATTORNEY 3 Exhibit “A” (copy of Tax Abatement Agreement to be attached) PAGE 1 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) STATE OF TEXAS § § COUNTY OF DALLAS § TAX ABATEMENT AGREEMENT This Tax Abatement Agreement (the “Agreement”) is entered into by and between the City of Coppell, Texas (the “City”), and Northpoint Hotel Group, LLC, a Texas limited liability company (“Owner”) (each a “Party” and collectively the “Parties”), acting by and through their authorized representatives. W I T N E S S E T H: WHEREAS, the City Council of the City of Coppell, Texas, (the “City Council”), passed an Ordinance (the “Ordinance”) establishing Tax Abatement Reinvestment Zone No. 102 (the “Zone”), for commercial/industrial tax abatement, as authorized by the Property Redevelopment and Tax Abatement Act, Chapter 312 of the Texas Tax Code, as amended (the “Tax Code”); and WHEREAS, the City has adopted guidelines for tax abatement (the “Tax Abatement Guidelines”); and WHEREAS, the Tax Abatement Guidelines contain appropriate guidelines and criteria governing tax abatement agreements to be entered into by the City as contemplated by the Tax Code; and WHEREAS, the City has adopted a resolution stating that it elects to be eligible to participate in tax abatement; and WHEREAS, in order to maintain and enhance the commercial and industrial economic and employment base of the Coppell area, it is in the best interests of the taxpayers for the City to enter into this Agreement in accordance with said Ordinance, the Tax Abatement Guidelines and the Tax Code; and WHEREAS, Owner owns the land located at 1155 Northpoint Drive, Coppell, Texas, being further described in Exhibit “A” (“Land”), and intends to construct or cause to be constructed thereon a Select Service Hotel (hereinafter defined) containing approximately 77,800 gross square feet of space and containing a minimum of one hundred forty (140) guest rooms, and not less than four thousand (4,000) square feet of meeting space, and other ancillary facilities such as reasonably required parking and landscaping more fully described in the submittals filed by Owner with the City, from time to time, in order to obtain a building permit(s) (hereinafter defined as the “Improvements”); and WHEREAS, Owner’s development efforts described herein will create permanent new jobs in the City; and WHEREAS, the City Council finds that the contemplated use of the Premises (hereinafter defined), and the contemplated Improvements are consistent with encouraging development of the PAGE 2 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) Zone in accordance with the purposes for its creation and/or in compliance with the Tax Abatement Guidelines, the Ordinance adopted by the City, the Tax Code and all other applicable laws; and WHEREAS, the City Council finds that the Improvements sought are feasible and practicable, and would be of benefit to the Premises to be included in the Zone and to the City after expiration of this Agreement; and WHEREAS, a copy of this Agreement has been furnished, in the manner prescribed by the Tax Code, to the presiding officers of the governing bodies of each of the taxing units in which the Premises are located; and NOW, THEREFORE, in consideration of the mutual benefits and promises contained herein and for other good and valuable consideration, the adequacy and receipt of which is hereby acknowledged, including the expansion of primary employment, the attraction of major investment in the Zone, which contributes to the economic development of Coppell and the enhancement of the tax base in the City, the Parties agree as follows: Article I Definitions Wherever used in this Agreement, the following terms shall have the meanings ascribed to them: “Affiliate” shall mean any entity under the common control or ownership of Company or its parent company. “Approved Franchise” shall mean a franchise agreement with an Approved Franchisor whereby the Owner is permitted to operate the Improvements using the name and reservation system of the Approved Franchisor. “Approved Franchisor” shall mean a national or international hotel franchisor, for a specific hotel product, approved by the City; provided, however, that the City shall not unreasonably withhold its consent to a franchisor which is one of the five (5) largest national or ten (10) largest international hotel chains as of such date. The City has approved Aloft as the initial Approved Franchisor. “Bankruptcy or Insolvency” shall mean the dissolution or termination of a Party’s existence as a going business, insolvency, appointment of receiver for any part of a Party’s property and such appointment is not terminated within ninety (90) days after such appointment is initially made, any general assignment for the benefit of creditors, or the commencement of any proceeding under any bankruptcy or insolvency laws by or against such Party, and such proceeding is not dismissed within ninety (90) days after the filing thereof. “Base Year Taxable Value” shall mean the Taxable Value for the Land for the year in which this Agreement is executed (2018). PAGE 3 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) “City” shall mean the City of Coppell, Texas, acting by and through its city manager, or designee. “Commencement of Construction” shall mean that: (i) the plans have been prepared and all approvals thereof and permits with respect thereto required by applicable governmental authorities have been obtained for construction of the Improvements; (ii) all necessary permits for the construction of the Improvements on the Land pursuant to the respective plans therefore having been issued by all applicable governmental authorities; and (iii) grading of the Land or the construction of the vertical elements of the Improvements has commenced. “Completion of Construction” shall mean: (i) substantial completion of the Improvements; and (ii) a final certificate of occupancy has been issued for the Company’s occupancy of the Improvements. “Effective Date” shall mean the last date of execution of this Agreement. “Expiration Date” shall mean March 1 of the calendar year following the seventh (7th) anniversary date of the First Year of Abatement. “First Year of Abatement” shall mean the calendar year commencing with January 1 of the calendar year immediately following the date of Completion of Construction of the Improvements. “Force Majeure” shall mean any contingency or cause beyond the reasonable control of a Party including, without limitation, acts of God or the public enemy, war, riot, civil commotion, insurrection, adverse weather, government or de facto governmental action (unless caused by acts or omissions of such Party), fires, explosions or floods, strikes, slowdowns or work stoppages. “Freeport Goods” shall have the same meaning as assigned by Section 11.251 of the Tax Code and Article VIII, Section 1-j of the Texas Constitution. Freeport Goods does not include “Goods in Transit” as defined by Tax Code, Section 11.253. “Goods in Transit” shall have the same meaning assigned by Tax Code, Section 11.253. “Improvements” shall mean a Select Service Hotel containing approximately 77,800 gross square feet of space and containing a minimum of one hundred forty (140) guest rooms, a minimum of approximately four thousand (4,000) square feet of meeting space and restaurant facilities at which food and beverages are prepared on site for at least two (2) meals per day (including breakfast), and other ancillary facilities such as reasonably required parking and landscaping more fully described in the submittals filed by Owner with the City, from time to time, in order to obtain a building permit(s), provided, however, that “Improvements” shall not include the Land. “Land” means the real property described in Exhibit “A”. “Owner” shall mean Northpoint Hotel Group, LLC, a Texas limited liability company. PAGE 4 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) “Premises” shall collectively mean the Improvements and the Land. “Related Agreement” shall mean any agreement, other than this Agreement, by and between the City and the Owner, its parent company, and any affiliated or related entity controlled or owned by Owner, or its parent company. “Required Use” shall mean the operation of the Improvements and related amenities as a Select Service Hotel open to the public and serving the adjacent business community and the citizens of the City, under and in accordance with the standards of an Approved Franchise. “Select Service Hotel” shall have the same meaning assigned by the City Comprehensive Zoning Ordinance, as amended. “Tangible Personal Property” shall mean furniture, fixtures and equipment owned or leased by Owner and located at the Improvements, subsequent to the execution of this Agreement. Tangible Personal Property shall not include inventory, Freeport Goods and Goods in Transit located at the Leased Premises. “Taxable Value” means the appraised value as certified by the Appraisal District as of January 1 of a given year. Article II General Provisions 2.1 Owner is the owner of the Land, or is under contract to purchase the Land, which Land is located within the city limits of the City and within the Zone. Owner intends to construct, or cause to be constructed, the Improvements on the Land. Owner intends to locate and maintain Tangible Personal Property at the Improvements following the Owner’s occupancy thereof. 2.2 The Premises are not in an improvement project financed by tax increment bonds. 2.3 This Agreement is entered into subject to the rights of the holders of outstanding bonds of the City. 2.4 The Premises are not owned or leased by any member of the Coppell City Council or any member of the Coppell Planning and Zoning Commission, or any member of the governing body of any taxing units joining in or adopting this Agreement. 2.5 Owner shall, before May 1, of each calendar year that the Agreement is in effect, certify in writing to the City that Owner is in compliance with each term of the Agreement. 2.6 The Premises at all times shall be used in the manner (i) that is consistent with the City’s Comprehensive Zoning Ordinance, as amended, and (ii) that, during the period taxes are abated hereunder, is consistent with the general purposes of encouraging development or redevelopment within the Zone. PAGE 5 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) Article III Tax Abatement Authorized 3.1 This Agreement is authorized by the Tax Code and in accordance with the City Tax Abatement Guidelines, and approved by resolution of the City Council. 3.2 Subject to the terms and conditions of this Agreement and provided the combined Taxable Value for the Improvements and the Tangible Personal Property, excluding the Land, is at least Five Million Five Hundred Thousand Dollars ($5,500,000.00), as of the First Year of Abatement and as of January 1 of each year thereafter that this Agreement is in effect, the City hereby grants Owner an abatement of the Taxable Value of the Improvements and of the Tangible Personal Property, for a period of seven (7) consecutive years beginning with the First Year of Abatement in accordance with schedule set forth below. The actual percentage of Taxable Value of the Improvements subject to abatement for each year this Agreement is in effect will apply only to the portion of the Taxable Value of the Improvements that exceeds the Base Year Taxable Value. The actual percentage of Taxable Value of the Tangible Personal Property subject to abatement for each year this Agreement is in effect will apply only to the Tangible Personal Property located at the Improvements subsequent to the execution of this Agreement. The failure of the Improvements and the Tangible Personal Property to have a combined Taxable Value of at least Five Million Five Hundred Thousand Dollars ($5,500,000.00) as of January 1 of any given Tax Year shall not be an event of default subject to termination and repayment of the abated taxes pursuant to Article V hereof, but shall result in the forfeiture of the tax abatement for the Improvements and the Tangible Personal Property for such Tax Year. Year Percentage of Abatement 1-5 75% 6-7 50% 3.3 The period of tax abatement herein authorized shall be for a period of seven (7) consecutive years beginning the First Year of Abatement. 3.4 During the period of tax abatement herein authorized, Owner shall be subject to all taxation not abated, including but not limited to, sales tax and ad valorem taxation on Land and inventory. 3.5 Owner agrees, subject to events of Force Majeure or to continuously own and occupy the Improvements for a period of at least seven (7) consecutive years beginning with the First Year of Abatement. 3.6 During the term of this Agreement following the First Year of Abatement the Improvements shall not be used for any purpose other than the Required Use and the operation and occupancy of the Improvements in conformance with the Required Use shall not cease for more than thirty (30) days except in connection with and to the extent of an event of Force Majeure. PAGE 6 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) 3.7 The term of this Agreement shall begin on the Effective Date and shall continue until the Expiration Date, unless sooner terminated as provided herein. Article IV Improvements 4.1 Owner owns or is under contract to purchase the Land and intends to construct or cause to be constructed thereon the Improvements. Nothing in this Agreement shall obligate Owner to construct the Improvements on the Land, or to locate the Tangible Personal Property on the Premises, but said actions are conditions precedent to tax abatement pursuant to this Agreement. 4.2 As a condition precedent to the initiation of the Owner’s tax abatement pursuant to this Agreement, Owner agrees, subject to events of Force Majeure, to cause Commencement of Construction of the Improvements to occur on or before December 31, 2018, and subject to events of Force Majeure to cause Completion of Construction of the Improvements to occur on or before June 30, 2020, as good and valuable consideration for this Agreement, and that all construction of the Improvements will be in accordance with all applicable state and local laws, codes, and regulations (or valid waiver thereof). 4.3 Construction plans for the Improvements constructed on the Land will be filed with the City, which shall be deemed to be incorporated by reference herein and made a part hereof for all purposes. 4.4 Owner agrees to maintain the Improvements during the term of this Agreement in accordance with all applicable state and local laws, codes, and regulations. 4.5 The City, its agents and employees shall have the right of access to the Premises during and following construction to inspect the Improvements at reasonable times and with reasonable notice to Owner, and in accordance with visitor access and security policies of the Owner, in order to insure that the construction of the Improvements are in accordance with this Agreement and all applicable state and local laws and regulations (or valid waiver thereof). Article V Default: Recapture of Tax Revenue 5.1 In the event the Owner: (i) fails to cause Commencement or Completion of Construction of the Improvements in accordance with this Agreement; (ii) has delinquent ad valorem or sales taxes owed to the City (provided Owner retains its right to timely and properly protest such taxes or assessment); (iii) suffers an event of “Bankruptcy or Insolvency”; or (iv) breaches any of the terms and conditions of this Agreement or a Related Agreement, then Owner after the expiration of the notice and cure periods described below, shall be in default of this Agreement. As liquidated damages in the event of such default, the Owner shall, within thirty (30) days after demand, pay to the City all taxes which otherwise would have been paid by the Owner to the City without benefit of a tax abatement, for the property the subject of this Agreement at the statutory rate for delinquent taxes as determined by Section 33.01 of the Tax Code, as amended, but without penalty. The Parties PAGE 7 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) acknowledge that actual damages in the event of default termination would be speculative and difficult to determine. The Parties further agree that any abated tax, including interest, as a result of this Agreement, shall be recoverable against the Owner, its successors and assigns and shall constitute a tax lien against the Tangible Personal Property and the Premises, and shall become due, owing and shall be paid to the City within thirty (30) days after notice of termination. 5.2 Upon breach by Owner of any of the obligations under this Agreement, the City shall notify Owner in writing, which shall have thirty (30) days from receipt of the notice in which to cure any such default. If the default cannot reasonably be cured within such 30-day period, and Owner has diligently pursued such remedies as shall be reasonably necessary to cure such default, then the City may extend the period in which the default must be cured. 5.3 If Owner fails to cure the default within the time provided as specified above or, as such time period may be extended, the City, at its sole option, shall have the right to terminate this Agreement by providing written notice to Owner. 5.4 Upon termination of this Agreement by City, all tax abated as a result of this Agreement, shall become a debt to the City as liquidated damages, and shall become due and payable not later than thirty (30) days after a notice of termination is provided. The City shall have all remedies for the collection of the abated tax provided generally in the Tax Code for the collection of delinquent property tax. The City at its sole discretion has the option to provide a repayment schedule. The computation of the abated tax for the purposes of the Agreement shall be based upon the full Taxable Value of the Tangible Personal Property and the Improvements without tax abatement for the years in which tax abatement hereunder was received by Owner, as determined by the Appraisal District, multiplied by the tax rate of the years in question, as calculated by the City Tax Assessor- Collector. The liquidated damages shall incur penalties as provided for delinquent taxes and shall commence to accrue after expiration of the thirty (30) day payment period. Article VI Annual Application for Tax Exemption It shall be the responsibility of Owner pursuant to the Tax Code, to file an annual exemption application form with the Chief Appraiser for the appraisal district for the Tangible Personal Property and the Improvements. A copy of the exemption application shall be submitted to the City upon request. Article VII Annual Rendition Owner shall annually render the value of the Tangible Personal Property and the Improvements to the Appraisal District and provide a copy of the same to the City upon written request. Article VIII Miscellaneous PAGE 8 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) 8.1 Notice. All notices required by this Agreement shall be addressed to the following, or other such other Party or address as either party designates in writing, by certified mail, postage prepaid, or by hand or overnight delivery: If intended for City, to: Attn: City Manager City of Coppell, Texas P. O. Box 478 Coppell, Texas 75019 With a copy to: Peter G. Smith Nichols, Jackson, Dillard, Hager & Smith, L.L.P. 1800 Ross Tower 500 North Akard Dallas, Texas 75201 If intended for Manager, to: Attn: Raj Akula Northpoint Hotel Group, LLC 768 Lexington Avenue Coppell, Texas 75019 8.2 Authorization. This Agreement was authorized by resolution of the City Council. 8.3 Severability. In the event any section, subsection, paragraph, sentence, phrase or word herein is held invalid, illegal or unconstitutional, the balance of this Agreement shall stand, shall be enforceable and shall be read as if the Parties intended at all times to delete said invalid section, subsection, paragraph, sentence, phrase or word. 8.4 Governing Law. This Agreement governed by the laws of the State of Texas. Venue for any action under this Agreement shall be the State District Court of Dallas County, Texas. The Parties agree to submit to the personal and subject matter jurisdiction of said court. 8.5 Counterparts. This Agreement may be executed in any number of counterparts, each of which shall be deemed an original and constitute one and the same instrument. 8.6 Entire Agreement. This Agreement embodies the complete agreement of the Parties hereto, superseding all oral or written previous and contemporary agreements between the Parties and relating to the matters in this Agreement, and except as otherwise provided herein cannot be modified without written agreement of the Parties to be attached to and made a part of this Agreement. 8.7 Recitals. The determinations recited and declared in the preambles to this Agreement are hereby incorporated herein as part of this Agreement. 8.8 Exhibits. All exhibits to this Agreement are incorporated herein by reference for all purposes wherever reference is made to the same. PAGE 9 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) 8.9 Employment of Undocumented Workers. During the term of this Agreement Owner agrees not to knowingly employ any undocumented workers and if convicted of a violation under 8 U.S.C. Section 1324a (f), such Owner shall repay the amount of the abated taxes pursuant to this Agreement as of the date of such violation within one hundred twenty (120) days after the date such Owner is notified by City of such violation, plus interest at the rate of four percent (4%) compounded annually from the date of violation until paid. Owner is not liable for a violation of this section by a subsidiary, affiliate, tenant or franchisee of the Owner or by a person with whom such Owner contracts. 8.10 Survival of Covenants. Any of the representations, warranties, covenants, and obligations of the Parties, as well as any rights and benefits of the Parties, pertaining to a period of time following the termination of this Agreement shall survive termination. 8.11 Successor and Assigns. This Agreement shall be binding on and inure to the benefit of the Parties and their respective heirs, executors, administrators, legal representatives, successors and permitted assigns. This Agreement may not be assigned without the prior written consent of the City Manager. Notwithstanding the foregoing, the Company may, upon thirty (30) days prior written notice to City, assign this Agreement to an Affiliate in connection with the sale and transfer of the Premises to an Affiliate provided: (i) the Improvements remain subject to an Approved Franchise; and (ii) such assignee executes and delivers to City a written assumption, in a form and substance reasonably approved by City, of all of the obligations of Owner under this Agreement. 8.12 Right of Offset. The City may at its option, offset any amounts due and payable under this Agreement against any debt (including taxes) lawfully due to the City from the Owner, regardless of whether the amount due arises pursuant to the terms of this Agreement, a Related Agreement or otherwise and regardless of whether or not the debt due the City has been reduced to judgment by a court. [Signature Page to Follow] PAGE 10 TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) EXECUTED in duplicate originals the ____ day of _______________, 2018. CITY OF COPPELL, TEXAS By: Karen Selbo Hunt, Mayor Attest: By: Christel Pettinos, City Secretary Approved as to Form: By:_______________________________ Robert E. Hager, City Attorney EXECUTED in duplicate originals the ____ day of _______________, 2018. NORTHPOINT HOTEL GROUP, LLC By: Suketu B. Patel Title: Manager PAGE 1 EXHIBIT “A” TO TAX ABATEMENT AGREEMENT – ALOFT HOTEL CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC TM 76078) EXHIBIT “A” (Legal Description of Land to be attached) Lots 1R2R and 1R3, Block 1 of the Northpoint Addition (5.253 acres) 1 RESOLUTION NO. ________________ A RESOLUTION OF THE CITY OF COPPELL, TEXAS, APPROVING THE TERMS AND CONDITIONS OF A TAX ABATEMENT AGREEMENT BY AND BETWEEN THE CITY OF COPPELL, TEXAS, AND NORTHPOINT HOTEL GROUP, LLC; AUTHORIZING ITS EXECUTION BY THE MAYOR; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City Council has been presented a proposed Tax Abatement Agreement by and between the City of Coppell, Texas, and Northpoint Hotel Group, LLC, a copy of which is attached hereto and incorporated herein by reference; and WHEREAS, upon full review and consideration of the Agreement, and all matters related thereto, the City Council is of the opinion and finds that the terms and conditions thereof should be approved, and that the Mayor should be authorized to execute the Agreement on behalf of the City of Coppell, Texas; NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF COPPELL, TEXAS, THAT: SECTION 1. The Agreement attached hereto having been reviewed by the City Council of the City of Coppell, Texas, and found to be acceptable and in the best interest of the City and its citizens, be, and the same is hereby, in all things approved, and the Mayor is hereby authorized to execute the Agreement on behalf of the City of Coppell, Texas. SECTION 2. The Council finds that the improvements proposed to be built upon the Premises described in the Agreement will enhance the economic vitality of the community through a combination of new capital investment, increased sales tax revenues, and the creation of additional job opportunities. SECTION 3. The improvements proposed for the Premises will accomplish the tax abatement guidelines of the City of Coppell, Texas. SECTION 4. The City Manager delivered to the presiding officer of the governing body of each taxing unit in which the property subject to the Agreement is located, a written notice 2 that the City of Coppell, Texas, intends to enter into the Agreement. The notice given by the City Manager included a copy of the Agreement approved by this Resolution. SECTION 5. This Resolution and the Tax Abatement Agreement are hereby approved by the affirmative vote of the majority of the members of the City Council of the City of Coppell, Texas, at a regularly scheduled meeting of the City Council. SECTION 6. This Resolution shall become effective immediately from and after its passage. DULY RESOLVED AND ADOPTED by the City Council of the City of Coppell, Texas, on this the ______ day of ________________, 2018. CITY OF COPPELL, TEXAS ___________________________________________ KAREN SELBO HUNT, MAYOR ATTEST: ___________________________________________ CHRISTEL PETTINOS, CITY SECRETARY APPROVED AS TO FORM: CITY ATTORNEY 3 Exhibit “A” (copy of Tax Abatement Agreement to be attached) PAGE 1 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) STATE OF TEXAS § § COUNTY OF DALLAS § TAX ABATEMENT AGREEMENT This Tax Abatement Agreement (the “Agreement”) is entered into by and between the City of Coppell, Texas (the “City”), and Northpoint Hotel Group, LLC, a Texas limited liability company (“Owner”) (each a “Party” and collectively the “Parties”), acting by and through their authorized representatives. W I T N E S S E T H: WHEREAS, the City Council of the City of Coppell, Texas, (the “City Council”), passed an Ordinance (the “Ordinance”) establishing Tax Abatement Reinvestment Zone No. 102 (the “Zone”), for commercial/industrial tax abatement, as authorized by the Property Redevelopment and Tax Abatement Act, Chapter 312 of the Texas Tax Code, as amended (the “Tax Code”); and WHEREAS, the City has adopted guidelines for tax abatement (the “Tax Abatement Guidelines”); and WHEREAS, the Tax Abatement Guidelines contain appropriate guidelines and criteria governing tax abatement agreements to be entered into by the City as contemplated by the Tax Code; and WHEREAS, the City has adopted a resolution stating that it elects to be eligible to participate in tax abatement; and WHEREAS, in order to maintain and enhance the commercial and industrial economic and employment base of the Coppell area, it is in the best interests of the taxpayers for the City to enter into this Agreement in accordance with said Ordinance, the Tax Abatement Guidelines and the Tax Code; and WHEREAS, Owner owns the land located at 1125 Northpoint, Coppell, Texas, being further described in Exhibit “A” (“Land”), and intends to construct or cause to be constructed thereon a Select Service Hotel (hereinafter defined) containing approximately 69,600 gross square feet of space and containing a minimum of one hundred twenty-five (125) guest rooms, and not less than twelve hundred (1,200) gross square feet of meeting space, and other ancillary facilities such as reasonably required parking and landscaping more fully described in the submittals filed by Owner with the City, from time to time, in order to obtain a building permit(s) (hereinafter defined as the “Improvements”); and WHEREAS, Owner’s development efforts described herein will create permanent new jobs in the City; and WHEREAS, the City Council finds that the contemplated use of the Premises (hereinafter defined), and the contemplated Improvements are consistent with encouraging development of the PAGE 2 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) Zone in accordance with the purposes for its creation and/or in compliance with the Tax Abatement Guidelines, the Ordinance adopted by the City, the Tax Code and all other applicable laws; and WHEREAS, the City Council finds that the Improvements sought are feasible and practicable, and would be of benefit to the Premises to be included in the Zone and to the City after expiration of this Agreement; and WHEREAS, a copy of this Agreement has been furnished, in the manner prescribed by the Tax Code, to the presiding officers of the governing bodies of each of the taxing units in which the Premises are located; and NOW, THEREFORE, in consideration of the mutual benefits and promises contained herein and for other good and valuable consideration, the adequacy and receipt of which is hereby acknowledged, including the expansion of primary employment, the attraction of major investment in the Zone, which contributes to the economic development of Coppell and the enhancement of the tax base in the City, the Parties agree as follows: Article I Definitions Wherever used in this Agreement, the following terms shall have the meanings ascribed to them: “Affiliate” shall mean any entity under the common control or ownership of Company or its parent company. “Approved Franchise” shall mean a franchise agreement with an Approved Franchisor whereby the Owner is permitted to operate the Improvements using the name and reservation system of the Approved Franchisor. “Approved Franchisor” shall mean a national or international hotel franchisor, for a specific hotel product, approved by the City; provided, however, that the City shall not unreasonably withhold its consent to a franchisor which is one of the five (5) largest national or ten (10) largest international hotel chains as of such date. The City has approved Holiday Inn as the initial Approved Franchisor. “Bankruptcy or Insolvency” shall mean the dissolution or termination of a Party’s existence as a going business, insolvency, appointment of receiver for any part of a Party’s property and such appointment is not terminated within ninety (90) days after such appointment is initially made, any general assignment for the benefit of creditors, or the commencement of any proceeding under any bankruptcy or insolvency laws by or against such Party, and such proceeding is not dismissed within ninety (90) days after the filing thereof. “Base Year Taxable Value” shall mean the Taxable Value for the Land for the year in which this Agreement is executed (2018). PAGE 3 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) “City” shall mean the City of Coppell, Texas, acting by and through its city manager, or designee. “Commencement of Construction” shall mean that: (i) the plans have been prepared and all approvals thereof and permits with respect thereto required by applicable governmental authorities have been obtained for construction of the Improvements; (ii) all necessary permits for the construction of the Improvements on the Land pursuant to the respective plans therefore having been issued by all applicable governmental authorities; and (iii) grading of the Land or the construction of the vertical elements of the Improvements has commenced. “Completion of Construction” shall mean: (i) substantial completion of the Improvements; and (ii) a final certificate of occupancy has been issued for the Company’s occupancy of the Improvements. “Effective Date” shall mean the last date of execution of this Agreement. “Expiration Date” shall mean March 1 of the calendar year following the seventh (7th) anniversary date of the First Year of Abatement. “First Year of Abatement” shall mean the calendar year commencing with January 1 of the calendar year immediately following the date of Completion of Construction of the Improvements. “Force Majeure” shall mean any contingency or cause beyond the reasonable control of a Party including, without limitation, acts of God or the public enemy, war, riot, civil commotion, insurrection, adverse weather, government or de facto governmental action (unless caused by acts or omissions of such Party), fires, explosions or floods, strikes, slowdowns or work stoppages. “Freeport Goods” shall have the same meaning as assigned by Section 11.251 of the Tax Code and Article VIII, Section 1-j of the Texas Constitution. Freeport Goods does not include “Goods in Transit” as defined by Tax Code, Section 11.253. “Goods in Transit” shall have the same meaning assigned by Tax Code, Section 11.253. “Improvements” shall mean a Full Service Hotel containing approximately 69,600 gross square feet of space, a minimum of one hundred twenty-five (125) guest rooms, a minimum of approximately 1,200 square feet of meeting space and restaurant facilities at which food and beverages are prepared on site for at least two (2) meals per day, and other ancillary facilities such as reasonably required parking and landscaping more fully described in the submittals filed by Owner with the City, from time to time, in order to obtain a building permit(s), provided, however, that “Improvements” shall not include the Land. “Land” means the real property described in Exhibit “A”. “Owner” shall mean Northpoint Hotel Group, LLC, a Texas limited liability company. “Premises” shall collectively mean the Improvements and the Land. PAGE 4 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) “Related Agreement” shall mean any agreement, other than this Agreement, by and between the City and the Owner, its parent company, and any affiliated or related entity controlled or owned by Owner, or its parent company. “Required Use” shall mean the operation of the Improvements and related amenities as a Select Service Hotel open to the public and serving the adjacent business community and the citizens of the City, under and in accordance with the standards of an Approved Franchise. “Select Service Hotel” shall have the same meaning assigned by the City Comprehensive Zoning Ordinance, as amended. “Tangible Personal Property” shall mean furniture, fixtures and equipment owned or leased by Owner and located at the Improvements, subsequent to the execution of this Agreement. Tangible Personal Property shall not include inventory, Freeport Goods and Goods in Transit located at the Leased Premises. “Taxable Value” means the appraised value as certified by the Appraisal District as of January 1 of a given year. Article II General Provisions 2.1 Owner is the owner of the Land, or is under contract to purchase the Land, which Land is located within the city limits of the City and within the Zone. Owner intends to construct, or cause to be constructed, the Improvements on the Land. Owner intends to locate and maintain Tangible Personal Property at the Improvements following the Owner’s occupancy thereof. 2.2 The Premises are not in an improvement project financed by tax increment bonds. 2.3 This Agreement is entered into subject to the rights of the holders of outstanding bonds of the City. 2.4 The Premises are not owned or leased by any member of the Coppell City Council or any member of the Coppell Planning and Zoning Commission, or any member of the governing body of any taxing units joining in or adopting this Agreement. 2.5 Owner shall, before May 1, of each calendar year that the Agreement is in effect, certify in writing to the City that Owner is in compliance with each term of the Agreement. 2.6 The Premises at all times shall be used in the manner (i) that is consistent with the City’s Comprehensive Zoning Ordinance, as amended, and (ii) that, during the period taxes are abated hereunder, is consistent with the general purposes of encouraging development or redevelopment within the Zone. PAGE 5 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) Article III Tax Abatement Authorized 3.1 This Agreement is authorized by the Tax Code and in accordance with the City Tax Abatement Guidelines, and approved by resolution of the City Council. 3.2 Subject to the terms and conditions of this Agreement and provided the combined Taxable Value for the Improvements and the Tangible Personal Property, excluding the Land, is at least Five Million Five Hundred Thousand Dollars ($5.500,000.00), as of the First Year of Abatement and as of January 1 of each year thereafter that this Agreement is in effect, the City hereby grants Owner an abatement of the Taxable Value of the Improvements and of the Tangible Personal Property, for a period of seven (7) consecutive years beginning with the First Year of Abatement in accordance with schedule set forth below. The actual percentage of Taxable Value of the Improvements subject to abatement for each year this Agreement is in effect will apply only to the portion of the Taxable Value of the Improvements that exceeds the Base Year Taxable Value. The actual percentage of Taxable Value of the Tangible Personal Property subject to abatement for each year this Agreement is in effect will apply only to the Tangible Personal Property located at the Improvements subsequent to the execution of this Agreement. The failure of the Improvements and the Tangible Personal Property to have a combined Taxable Value of at least Five Million Five Hundred Thousand Dollars ($5,500,000.00) as of January 1 of any given Tax Year shall not be an event of default subject to termination and repayment of the abated taxes pursuant to Article V hereof, but shall result in the forfeiture of the tax abatement for the Improvements and the Tangible Personal Property for such Tax Year. Year Percentage of Abatement 1-5 75% 6-7 50% 3.3 The period of tax abatement herein authorized shall be for a period of seven (7) consecutive years beginning the First Year of Abatement. 3.4 During the period of tax abatement herein authorized, Owner shall be subject to all taxation not abated, including but not limited to, sales tax and ad valorem taxation on Land and inventory. 3.5 Owner agrees, subject to events of Force Majeure or to continuously own and occupy the Improvements for a period of at least seven (7) consecutive years beginning with the First Year of Abatement. 3.6 During the term of this Agreement following the First Year of Abatement the Improvements shall not be used for any purpose other than the Required Use and the operation and occupancy of the Improvements in conformance with the Required Use shall not cease for more than thirty (30) days except in connection with and to the extent of an event of Force Majeure. PAGE 6 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) 3.7 The term of this Agreement shall begin on the Effective Date and shall continue until the Expiration Date, unless sooner terminated as provided herein. Article IV Improvements 4.1 Owner owns or is under contract to purchase the Land and intends to construct or cause to be constructed thereon the Improvements. Nothing in this Agreement shall obligate Owner to construct the Improvements on the Land, or to locate the Tangible Personal Property on the Premises, but said actions are conditions precedent to tax abatement pursuant to this Agreement. 4.2 As a condition precedent to the initiation of the Owner’s tax abatement pursuant to this Agreement, Owner agrees, subject to events of Force Majeure, to cause Commencement of Construction of the Improvements to occur on or before May 31, 2019, and subject to events of Force Majeure to cause Completion of Construction of the Improvements to occur on or before December 31, 2020, as good and valuable consideration for this Agreement, and that all construction of the Improvements will be in accordance with all applicable state and local laws, codes, and regulations (or valid waiver thereof). 4.3 Construction plans for the Improvements constructed on the Land will be filed with the City, which shall be deemed to be incorporated by reference herein and made a part hereof for all purposes. 4.4 Owner agrees to maintain the Improvements during the term of this Agreement in accordance with all applicable state and local laws, codes, and regulations. 4.5 The City, its agents and employees shall have the right of access to the Premises during and following construction to inspect the Improvements at reasonable times and with reasonable notice to Owner, and in accordance with visitor access and security policies of the Owner, in order to insure that the construction of the Improvements are in accordance with this Agreement and all applicable state and local laws and regulations (or valid waiver thereof). Article V Default: Recapture of Tax Revenue 5.1 In the event the Owner: (i) fails to cause Commencement or Completion of Construction of the Improvements in accordance with this Agreement; (ii) has delinquent ad valorem or sales taxes owed to the City (provided Owner retains its right to timely and properly protest such taxes or assessment); (iii) suffers an event of “Bankruptcy or Insolvency”; or (iv) breaches any of the terms and conditions of this Agreement or a Related Agreement, then Owner after the expiration of the notice and cure periods described below, shall be in default of this Agreement. As liquidated damages in the event of such default, the Owner shall, within thirty (30) days after demand, pay to the City all taxes which otherwise would have been paid by the Owner to the City without benefit of a tax abatement, for the property the subject of this Agreement at the statutory rate for delinquent taxes as determined by Section 33.01 of the Tax Code, as amended, but without penalty. The Parties PAGE 7 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) acknowledge that actual damages in the event of default termination would be speculative and difficult to determine. The Parties further agree that any abated tax, including interest, as a result of this Agreement, shall be recoverable against the Owner, its successors and assigns and shall constitute a tax lien against the Tangible Personal Property and the Premises, and shall become due, owing and shall be paid to the City within thirty (30) days after notice of termination. 5.2 Upon breach by Owner of any of the obligations under this Agreement, the City shall notify Owner in writing, which shall have thirty (30) days from receipt of the notice in which to cure any such default. If the default cannot reasonably be cured within such 30-day period, and Owner has diligently pursued such remedies as shall be reasonably necessary to cure such default, then the City may extend the period in which the default must be cured. 5.3 If Owner fails to cure the default within the time provided as specified above or, as such time period may be extended, the City, at its sole option, shall have the right to terminate this Agreement by providing written notice to Owner. 5.4 Upon termination of this Agreement by City, all tax abated as a result of this Agreement, shall become a debt to the City as liquidated damages, and shall become due and payable not later than thirty (30) days after a notice of termination is provided. The City shall have all remedies for the collection of the abated tax provided generally in the Tax Code for the collection of delinquent property tax. The City at its sole discretion has the option to provide a repayment schedule. The computation of the abated tax for the purposes of the Agreement shall be based upon the full Taxable Value of the Tangible Personal Property and the Improvements without tax abatement for the years in which tax abatement hereunder was received by Owner, as determined by the Appraisal District, multiplied by the tax rate of the years in question, as calculated by the City Tax Assessor- Collector. The liquidated damages shall incur penalties as provided for delinquent taxes and shall commence to accrue after expiration of the thirty (30) day payment period. Article VI Annual Application for Tax Exemption It shall be the responsibility of Owner pursuant to the Tax Code, to file an annual exemption application form with the Chief Appraiser for the appraisal district for the Tangible Personal Property and the Improvements. A copy of the exemption application shall be submitted to the City upon request. Article VII Annual Rendition Owner shall annually render the value of the Tangible Personal Property and the Improvements to the Appraisal District and provide a copy of the same to the City upon written request. PAGE 8 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) Article VIII Miscellaneous 8.1 Notice. All notices required by this Agreement shall be addressed to the following, or other such other Party or address as either party designates in writing, by certified mail, postage prepaid, or by hand or overnight delivery: If intended for City, to: Attn: City Manager City of Coppell, Texas P. O. Box 478 Coppell, Texas 75019 With a copy to: Peter G. Smith Nichols, Jackson, Dillard, Hager & Smith, L.L.P. 1800 Ross Tower 500 North Akard Dallas, Texas 75201 If intended for Manager, to: Attn: Raj Akula Northpoint Hotel Group, LLC 768 Lexington Avenue Coppell, Texas 75019 8.2 Authorization. This Agreement was authorized by resolution of the City Council. 8.3 Severability. In the event any section, subsection, paragraph, sentence, phrase or word herein is held invalid, illegal or unconstitutional, the balance of this Agreement shall stand, shall be enforceable and shall be read as if the Parties intended at all times to delete said invalid section, subsection, paragraph, sentence, phrase or word. 8.4 Governing Law. This Agreement governed by the laws of the State of Texas. Venue for any action under this Agreement shall be the State District Court of Dallas County, Texas. The Parties agree to submit to the personal and subject matter jurisdiction of said court. 8.5 Counterparts. This Agreement may be executed in any number of counterparts, each of which shall be deemed an original and constitute one and the same instrument. 8.6 Entire Agreement. This Agreement embodies the complete agreement of the Parties hereto, superseding all oral or written previous and contemporary agreements between the Parties and relating to the matters in this Agreement, and except as otherwise provided herein cannot be modified without written agreement of the Parties to be attached to and made a part of this Agreement. 8.7 Recitals. The determinations recited and declared in the preambles to this Agreement are hereby incorporated herein as part of this Agreement. PAGE 9 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) 8.8 Exhibits. All exhibits to this Agreement are incorporated herein by reference for all purposes wherever reference is made to the same. 8.9 Employment of Undocumented Workers. During the term of this Agreement Owner agrees not to knowingly employ any undocumented workers and if convicted of a violation under 8 U.S.C. Section 1324a (f), such Owner shall repay the amount of the abated taxes pursuant to this Agreement as of the date of such violation within one hundred twenty (120) days after the date such Owner is notified by City of such violation, plus interest at the rate of four percent (4%) compounded annually from the date of violation until paid. Owner is not liable for a violation of this section by a subsidiary, affiliate, tenant or franchisee of the Owner or by a person with whom such Owner contracts. 8.10 Survival of Covenants. Any of the representations, warranties, covenants, and obligations of the Parties, as well as any rights and benefits of the Parties, pertaining to a period of time following the termination of this Agreement shall survive termination. 8.11 Successor and Assigns. This Agreement shall be binding on and inure to the benefit of the Parties and their respective heirs, executors, administrators, legal representatives, successors and permitted assigns. This Agreement may not be assigned without the prior written consent of the City Manager. Notwithstanding the foregoing, the Company may, upon thirty (30) days prior written notice to City, assign this Agreement to an Affiliate in connection with the sale and transfer of the Premises to an Affiliate provided: (i) the Improvements remain subject to an Approved Franchise; and (ii) such assignee executes and delivers to City a written assumption, in a form and substance reasonably approved by City, of all of the obligations of Owner under this Agreement. 8.12 Right of Offset. The City may at its option, offset any amounts due and payable under this Agreement against any debt (including taxes) lawfully due to the City from the Owner, regardless of whether the amount due arises pursuant to the terms of this Agreement, a Related Agreement or otherwise and regardless of whether or not the debt due the City has been reduced to judgment by a court. [Signature Page to Follow] PAGE 10 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) EXECUTED in duplicate originals the ____ day of _______________, 2018. CITY OF COPPELL, TEXAS By: Karen Selbo Hunt, Mayor Attest: By: Christel Pettinos, City Secretary Approved as to Form: By:_______________________________ Robert E. Hager, City Attorney EXECUTED in duplicate originals the ____ day of _______________, 2018. NORTHPOINT HOTEL GROUP, LLC By: Suketu B. Patel, Manager PAGE 11 TAX ABATEMENT AGREEMENT – HOLIDAY INN EXPRESS CITY OF COPPELL AND NORTHPOINT HOTEL GROUP, LLC (TM 76079) EXHIBIT “A” (Legal Description of Land) Lots 1R2R and 1R3, Block 1 of the Northpoint Addition (5.253 acres) ! " !"#$% !"& #$ %$& $ $ '$ "(' )) ' $ (&$ * $+ '"$, $- ''("$ !%"$ .$", '#"" "' .$ ''("$ !%"$/"/$ "$+'$ . "* $+ '"$, $- 00"$+ '1'"!$+'$ 2"!$ '!" " $ )$&$ ! * $+ '"$, $- ''("$ !%"$ 2% .$", '#"".''("$ !%"$ .$.''("$ !%"$ , '#"". (&*$ )$&$ +$, ! $& )&- ! ! + .,- (&$ % %$ ! ! ! "$ ! (&$, /' # $ )3)'$ "(' .,- '$ "' .$ ''("$ !%"$/"/$ "$+'$ . " * $+ '"$, $- 00"$+ '1'"!$+'$2"!$ '!" 4%% )&- " * $+ '"$, $- 00'( "$($'"!$ + $ "3( ."+ .$, $ ($'(+ $ '/ ($$* $+ '"$5'+'+ $ '( "$'" '%$! 6.$ .("%'"'%% .!$ %"" $ $+"6.$ .%$'"!(, '#""($'(+ $ ' / ($$* $+ '"$5'#$ '( "$'"!$ %"6.$ . %$'"!( '$+'"776. $/''"!(+''("$ !%"$!"$" !" "'$ .$+, $)2 $8(("(. ' .+"'$ %"$$ * $+ '"$, $- 00. $+ .$+%$'"!( '$+'"(+/''"! +%$'"!( ' $(''(("$"$+ '1/+$3 .$+ +("$!"'. 9:. " & & " %&$'$ %%"'$5 %"$( %%" 0 &$ /$ 1 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference: Consider approval of two Civic Center Agreements by and between the City of Coppell and Northpoint Hotel Group, LLC, and authorizing the City Manager to sign. 2030: Business Prosperity Executive Summary: Northpoint Hotel Group, LLC is constructing two hotels with meeting space. Reinvestment Zone No. 102 is being created for this property, which is located south of Northpoint Drive and west of S. Royal Lane. Introduction: Northpoint Hotel Group, LLC is constructing two select service hotels. The Aloft Hotel, located at 1155 Northpoint Drive, will contain approximately 77,800 gross square feet of space, a minimum of 140 guest rooms and not less than 4,000 square feet of meeting space. Holiday Inn Express, located at 1125 Northpoint Drive, will contain approximately 69,600 square feet of space, a minimum of 125 guest room and not less than 1,200 square feet of meeting space. Each Civic Center Agreement grants an expenditure of the Hotel/Motel Occupancy Tax for a period of 2 years. These expenditures are payment to Northpoint Hotel Group, LLC for the use of the meeting space, which will operate as a civic center and is authorized by Chapter 351 of the Tax Code. Analysis: Each Civic Center Agreement grants a rebate of the Hotel/Motel Occupancy Tax as follows: 100% for years 1 and 2. Legal Review: The documents were created by Pete Smith. 2 Fiscal Impact: N/A Recommendation: Community Development recommends approval. Page 1 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) STATE OF TEXAS § § COUNTY OF DALLAS § CIVIC CENTER AGREEMENT This Civic Center Development Agreement (“Agreement”) is made by and between the City of Coppell, Texas (“City”), and Northpoint Hotel Group, LLC, a Texas limited liability company (the “Company”) (collectively the “Parties,” or singularly as a “Party”), acting by and through their respective authorized officers and representatives. WITNESSETH: WHEREAS, Chapter 351, Tax Code authorizes the City to expend hotel/motel occupancy tax revenue for the acquisition, lease, construction, improvement, enlarging, maintenance, equipping and operation of a convention center facility which includes civic centers, auditoriums, parking areas and auditoriums, owned or managed by the City; and WHEREAS, a Civic Center (hereinafter defined) located in a hotel and conference center located in the City, will enhance and promote tourism and the hotel and convention industry and will attract visitors from outside the City into the City or its vicinity; and WHEREAS, Company owns the land located at 1155 Northpoint, Coppell, Texas, being further described in Exhibit “A” (“Land”), and intends to construct or cause to be constructed thereon a Full Service Hotel (hereinafter defined) containing approximately 77,800 gross square feet of space and containing a minimum of one hundred forty (140) guest rooms (the “Hotel”), and not less than four thousand (4,000) gross square feet of meeting space attached to the Hotel (the “Conference Center”), and other ancillary facilities such as reasonably required parking and landscaping more fully described in the submittals filed by Company with the City, from time to time, in order to obtain a building permit(s) (collectively the Hotel and Conference Center referred to as the “Improvements” or as the “Hotel and Conference Center”); and WHEREAS, Company intends to allow the City to use a designated portion of the Conference Center as Civic Center; and WHEREAS, City intends, as lessee of the Conference Center, to contract with the Company to manage and operate the Civic Center for the City; and WHEREAS, City has found and determined that the expenditure of hotel/motel occupancy tax revenue for the lease, operation, and management of the designated portion of the Conference Center, as a Civic Center, is authorized by Chapter 351, Tax Code, and will benefit the City; and WHEREAS, promoting the location of new business enterprises within City will promote economic development, stimulate commercial activity, generate additional sales tax and will enhance the property tax base and economic vitality of City; and Page 2 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) WHEREAS, City has adopted programs for promoting economic development, and this Agreement and the economic development incentives set forth herein are given and provided by City pursuant to and in accordance with those programs; and WHEREAS, the waiver of roadway impact fees and building inspection fees as set forth herein furthers economic development in City and conforms to the programs adopted by City for promoting economic development in City and will enhance the drainage system of the City; and WHEREAS, City is authorized by Article III, Section 52-a of the Texas Constitution and Texas Local Government Code Chapter 380 to provide economic development grants to promote local economic development and to stimulate business and commercial activity in City; and WHEREAS, City has determined that making an economic development grant consisting of the waiver of roadway impact fees and building inspection fees as set forth herein to Company in accordance with City’s economic development program will (i) further the economic development objectives of City; (ii) benefit City and City’s inhabitants; and (iii) promote local economic development and stimulate business and commercial activity in City; and WHEREAS, City Council does hereby approve this Agreement as a program for making an economic development grant to Company for the purpose of stimulating and maintaining its commercial activity within City, and to promote the generation of sales tax, the enhancement of the property tax base, and to maintain and increase the economic vitality of City and to provide for enhancements to the entire City drainage system; NOW THEREFORE, in consideration of the foregoing, and other valuable consideration, the receipt and sufficiency of which is hereby acknowledged, the Parties agree as follows: Article I Findings and Determinations The City Council hereby finds and determines that: (i) City is authorized to enter into this Agreement; (ii) Chapter 351, Tax Code authorizes the expenditure of City hotel/motel occupancy tax revenue for the lease, operation and management of the Conference Center; (iii) the use and management of the Conference Center as a municipal civic center is authorized by Chapter 351, Tax Code and will enhance and promote tourism and the hotel and convention industry and will attract visitors from outside the City into the City or its vicinity; and (iv) the City is authorized to contract for the management of the Conference Center for use as a civic center. Article II Term The term of this Agreement (“Term”) shall commence on the Effective Date and shall continue until the Expiration Date, unless sooner terminated. Article III Page 3 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) Definitions Wherever used in this Agreement, the following terms shall have the meaning ascribed to them unless the context clearly indicates otherwise: “Affiliate” shall mean any entity under the common control or ownership of Company or its parent company. “Approved Franchise” shall mean franchise agreements with Approved Franchisor whereby the Company is permitted to operate the Hotel and Conference Center using the name and reservation system of the Approved Franchisor. “Approved Franchisor” shall mean national or international hotel franchisors, for a specific hotel product, approved by the City; provided, however, that the City shall not unreasonably withhold its consent to a franchisor of a Hotel and Conference Center, and which is one of the five (5) largest national or ten (10) largest international hotel chains as of such date. The City has approved Aloft as the initial Approved Franchisor. “Bankruptcy or Insolvency” shall mean the dissolution or termination of the Party’s existence, insolvency, employment of a receiver for any part of Company’s property and such appointment is not terminated within ninety (90) days after such appointment is initially made, any general assignment for the benefit of creditors or the commencement of any proceedings under any bankruptcy or insolvency laws by or against the Party and such proceedings are not dismissed within ninety (90) days after the filing thereof. “Casualty” shall mean the Improvements are wholly or partially destroyed by fire, earthquake, flood or similar casualty that renders the Improvements unfit for the intended purpose. “City” shall mean the City of Coppell, Texas. “Civic Center” shall mean the use of designated portions of the Conference Center by the City for use as a municipal civic center pursuant to Tax Code Chapter 351 as set forth in Section 5.3. “Commencement Date” shall mean the later of: (i) the date the first final permanent certificate of occupancy is issued by the City for the Hotel and Conference Center; and (ii) the date the Hotel and Conference Center are open for business and serving the citizens of the City and its visitors. “Commencement of Construction” shall mean that: (i) the plans have been prepared and all approvals thereof and permits with respect thereto required by applicable governmental authorities have been obtained for construction of the Improvements; (ii) all necessary permits for the construction of the Improvements on the Land, pursuant to the respective plans therefore having been issued by all applicable governmental authorities; and (iii) grading of the Land or the construction of the vertical elements of the Improvements has commenced. Page 4 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) “Company” shall mean Northpoint Hotel Group, LLC, a Texas limited liability company. “Completion of Construction” shall mean: (i) substantial completion of the Improvements; and (ii) a final certificate of occupancy has been issued for the Company’s occupancy of the Improvements. “Conference Center” shall mean that portion of the Improvements dedicated and used as a full service, upscale, conference center containing not less than four thousand (4,000) gross square feet of conference space. “Effective Date” shall mean the last date of execution of this Agreement. “Expiration Date” shall mean the seventh (7th) anniversary date of the Commencement Date. “Force Majeure” shall mean any contingency or cause beyond the reasonable control of a Party including, without limitation, acts of God or the public enemy, war, riot, civil commotion, insurrection, government or de facto governmental action (unless caused by the intentionally wrongful acts or omissions of the Party), fires, explosions or floods, strikes, slowdowns or work stoppages. “Hotel” shall mean a Select Service Hotel containing approximately 77,800 gross square feet of space and containing a minimum of one hundred forty (140) guest rooms. “Hotel Occupancy Tax” or “HOT” shall mean the City’s receipt of tax imposed by the City pursuant to Chapter 351, Tax Code, as amended, on a person who, under a lease, concession, permit, right of access, license, contract or agreement pays for the use or possession or possession of a sleeping room in the Hotel during the calendar year immediately preceding each Rent payment date. “Hotel Tax Report” shall have the same meaning assigned by Tax Code, Chapter 156.151, or if such report is not available then a written certificate or statement authenticated by an appropriate management official of the Company that contains the amount of Hotel Occupancy Tax collected by the Company and paid to the City and to the State Comptroller, or its successor, for the preceding calendar quarter. Such report shall include the total amount of the payments made for sleeping rooms at the Hotel and Conference Center during the preceding reporting period; and the amount of the HOT collected by the Hotel and Conference Center during the preceding reporting period. “Impositions” shall mean all taxes, assessments, use and occupancy taxes, charges, excises, license and permit fees, and other charges by public or governmental authority, general and special, ordinary and extraordinary, foreseen and unforeseen, which are or may be assessed, charged, levied, or imposed by any public or governmental authority on Improvements, the Company, of Company Affiliate, the then owner or operator of the Improvements or any property or any business owned by Company and/or Company Affiliates within the City. Page 5 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) “Improvements” or “Hotel and Conference Center” shall mean collectively, the Hotel and attached Conference Center further described as a Select Service Hotel containing approximately 77,800 gross square feet of space and containing a minimum of one forty (140) guest rooms, and not less than four thousand (4,00) gross square feet of meeting space, and other ancillary facilities such as reasonably required parking and landscaping more fully described in the submittals filed by Company with the City, from time to time, in order to obtain a building permit(s). “Land” means the real property described in Exhibit “A”. “Lease Term” mean two (2) consecutive periods of twelve (12) months beginning on the Commencement Date. “Premises” shall mean the Land and the Improvements following construction thereof. “Related Agreement” shall mean any agreement, other than this Agreement, by and between the City and the Company, its parent company, and any affiliated or related entity controlled or owned by Company, or its parent company. “Rent” shall mean for years 1 and 2 of the Lease Term an amount equal to one hundred percent (100%) of the maximum amount allowed by law of the Hotel Occupancy Tax. “Required Use” shall mean the operation of the Hotel and Conference Center, and related amenities, open to the public and serving the adjacent business community and the citizens of the City, under and in accordance with the standards of an Approved Franchise. “Select Service Hotel” shall have the same meaning assigned by the City Comprehensive Zoning Ordinance, as amended. Article IV Hotel and Conference Center 4.1 Construction of Hotel and Conference Center. Company shall, subject to events of Force Majeure, cause Commencement of Construction of the Hotel and Conference Center to occur on or before December 31, 2018; and subject to events of Force Majeure, cause Completion of Construction of Hotel and Conference Center to occur on or before June 30, 2020. 4.2 Inspection/Access. The City, its agents and employees, shall have the right of reasonable access to the Hotel and Conference Center during construction to inspect the Hotel and Conference Center, at reasonable times during normal business hours and with reasonable notice to Company and in accordance with their visitor access and security policies, in order to insure that the construction is in accordance with this Agreement and all applicable state and local laws and regulations (or valid waiver thereof). 4.3 Casualty and Condemnation. Page 6 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) (a) If the Hotel and Conference Center are damaged partially or destroyed by Casualty, regardless of the extent of the damage or destruction, Company shall, subject to events of Force Majeure and the availability of adequate insurance proceeds, within two hundred seventy (270) days from the date of such Casualty commence to repair, reconstruct or replace the damaged or destroyed portion of the Hotel and/or Conference Center, as applicable, and pursue the repair, reconstruction, or replacement with reasonable diligence so as to restore the Hotel and Conference Center to substantially the condition it was in before the Casualty. In the event, Company fails to timely repair, restore or reconstruct the Hotel and Conference Center and complete the same within eighteen (18) months from the date Company commences the restoration work, this Agreement and the City’s obligation to pay any Rent shall terminate. The City shall not be obligated to pay Rent during any period for the repair, restoration or reconstruction of the Hotel and Conference Center. (b) If the Hotel and Conference Center or any material portion thereof is taken for public or quasi-public purposes by condemnation as a result of any action or proceeding in eminent domain, or transferred in lieu of condemnation to any authority entitled to exercise the power of eminent domain, this Agreement and the City’s obligation to pay any Rent shall terminate. 4.4 Required Use. Beginning on the Commencement Date, and continuing thereafter until the Expiration Date, or earlier termination, the Hotel and Conference Center shall not be used for any purpose other than the Required Use and the Company shall not allow the operation of the Hotel and Conference Center in conformance with the Required Use to cease for more than thirty (30) days, except: (i) in connection with and to the extent of an event of Casualty or Force Majeure, and (ii) except in connection with any cessation of not more than ninety (90) days that is due to a change in the Approved Franchisor. Article V Civic Center 5.1 Lease. In consideration of the covenants, agreements and conditions set forth herein, Company does hereby lease, let, demise and rent, for the Lease Term and City does hereby rent and lease from Company for the Lease Term, the Civic Center for the Civic Center Use (as defined in Section 5.3 (b) of this Agreement). 5.2 Rent. (a) Subject to the continued satisfaction of the terms and conditions of this Agreement by the Company and provided the Company has timely caused Commencement and Completion of Construction of the Hotel and Conference Center to occur the City shall, during the Lease Term, pay to Company or to such person or entity as Company shall designate in writing, Rent, for the use and occupancy of the Civic Center, and as consideration for Company’s management of the Civic Center for the City. Rent shall be paid on an annual basis within sixty (60) days after the end of each of the two (2) consecutive twelve (12) month periods following the Commencement Date. Any payment made by the City hereunder is limited to the extent of the lawfully available Page 7 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) funds from the City’s receipts from the collection of the Hotel Occupancy Tax revenue imposed pursuant to Chapter 351, Tax Code attributable to the occupancy of sleeping rooms at the Hotel. (b) The obligation of the City to pay Rent shall be conditioned upon the compliance and satisfaction of the terms and conditions of this Agreement by Company and each of the following: (i) Good Standing. Company shall not have an uncured breach or default of this Agreement or a Related Agreement. (ii) Required Use. During the Term of this Agreement following the Commencement Date and continuing thereafter until the Expiration Date, or earlier termination, the Hotel and Conference Center shall not be used for any purpose other than the Required Use, and that Company shall not allow the use and operation of the Hotel and Conference Center in conformance with the Required Use to cease for more than thirty (30) days, except (i) in connection with, and to the extent of an event of Force Majeure, or (ii) in connection with any cessation of not more than ninety (90) days that is due to a change in the Approved Franchisor. (iii) Hotel Tax Reports. Company shall have timely delivered the Hotel Tax Reports to the City for the applicable calendar year as provided by Section 5.5; and (iv) Receipt of HOT. City shall have received HOT for the applicable calendar year. 5.3 Conditions of Use. (a) Company Exclusive Use. Company shall have exclusive use of the Hotel and Conference Center, except the City may use the Civic Center portion of the Conference Center for Civic Center Use as set forth in this Section 5.3. (b) Civic Center Use. As consideration for the Rent City shall, without charge or expense, be entitled to the use of the main ballroom and the meeting rooms at least six (6) times (each such use not to exceed two (2) consecutive days unless otherwise agreed by the Parties) each calendar year upon ninety (90) days prior written notice, and at additional times as may be agreed by the Parties when available (“Civic Center Use”). All other uses, if any, of the Conference Center by the City shall be at times mutually approved by Company and the City. Any food and beverage, set up, cleaning or other agreed services shall be charged to the City at Company’s direct cost to provide the same. Civic Center Use must conform to the Approved Franchise uses, except that the City is not required to use the food and beverage services of the Hotel and Conference Center during Civic Center Use, and may cater food and beverages during periods of Civic Center Use. (c) Civic Center Standards. Company shall equip and furnish the Civic Center portion of the Conference Center in such manner that it is readily useable by the City as a municipal civic center for the booking of business conventions, meetings, and similar activities. Company shall keep and maintain the Conference Center in a good state of appearance and repair (except for Page 8 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) reasonable wear and tear) at Company’s own expense. City shall be responsible for, and pay for any damages to, the Civic Center and/or the Conference Center, or promptly repair any such damages that occur during the City’s use of the Conference Center. 5.4 Management Duties. The Company shall maintain, manage and operate the Civic Center on behalf of the City. The Company will cause the Civic Center to be operated and maintained according to this Agreement. The Company agrees to provide management services at least equal to those provided for comparable facilities in the DFW Metroplex. 5.5 Hotel Tax Report. Company shall provide, or cause the Hotel Operator to provide, the City with a Hotel Tax Report within thirty (30) days after the end of each calendar month beginning with the thirtieth (30th) day immediately following the last day of the month in which the Commencement Date occurs and continuing thereafter on the thirtieth (30th) day after each calendar month during the Lease Term. The Hotel Tax Report shall be accompanied by a copy of the Hotel and Conference Center report required to be submitted to the Comptroller of the State of Texas, or its successor, pursuant to Texas Tax Code Section 156.151. For purposes of payment of Rent pursuant to this Agreement only and for no other purpose, if the Hotel Tax Report is not submitted within one hundred eighty (180) days after the date the respective report is due, then Company is deemed to have forfeited payment of Rent by the City for the period to which the undelivered report relates. The City shall not be required to pay any Rent for any calendar year during the Lease Term for so long as the City has not received Hotel Occupancy Tax in full for such period. 5.6 Hotel Tax Records. The Company shall keep and maintain accurate records of the Hotel Occupancy Tax collected by the Company and paid to the City, and to the State Comptroller, or successor agency, during the term of this Agreement that is paid by the occupant of each sleeping room in the Improvements. Such records shall include, but not be limited to, at a minimum, guest folios, tax exemption certificates, and any original documents such as posting ledgers and rate and stay adjustment reports. These records may be retained in any retrievable format, including but not limited to micro form; shall be maintained for a period of not less than five (5) years; and shall be available for inspection upon request by any employee, agent, officer or representative of the City at all reasonable times. Any adjustments or allowances made or granted shall be reported to the City on a form prescribed by the City. 5.7 Hotel Records Inspection; Annual Audit. The City shall have the right to audit the books and records of Company pertaining to the operation of the Hotel and Conference Center and any operator thereof during normal business hours upon prior written notice thereof to determine the correctness of the Hotel Tax Reports or the amount of taxes due City and/or State of Texas under Texas Tax Code Chapter 351 and/or 156. Company agrees to pay the cost of an annual audit of the Hotel Tax Records to be performed by an independent party selected by the City. Company shall cause the Hotel Operator to cooperate with the City with any such audit. Article VI Page 9 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) Termination; Repayment 6.1 Termination. This Agreement terminates upon any one or more of the following: (a) by written agreement of the Parties; (b) at 11:59 pm Dallas, Texas, time on the Expiration Date; (c) upon written notice by either Party in the event the other Party breaches any of the terms or conditions of this Agreement or a Related Agreement and such breach is not cured within sixty (60) days after written notice thereof in accordance with this Agreement; (d) upon written notice by the City, if Company suffers an event of Bankruptcy or Insolvency; (e) upon written notice by the City, if any Impositions owed to the City or the State of Texas by Company shall become delinquent after thirty (30) days written notice is delivered pursuant to this Agreement (provided, however, Company retains the right to timely and properly protest and contest any such Impositions); (f) upon written notice by either Party, if any subsequent Federal or State legislation or any decision of a court of competent jurisdiction declares or renders this Agreement in whole, but not in part, invalid, illegal or unenforceable; or (g) upon written notice by either Party, if any decision of a court of competent jurisdiction declares or renders this Agreement invalid, illegal or unenforceable. 6.2 In the event this Agreement is terminated by the City pursuant to Section 6.1 (c), (d), (e), or (f), the City shall be relieved of any further obligation to pay any Rent to the Company and Company shall immediately pay to City an amount equal to the Rent previously paid by City to Company, as of the date of termination, and the amount of the Impact Fee Waiver and Building Inspection fee Waiver, plus interest at the rate periodically announced by the Wall Street Journal as the prime or base commercial lending rate, or if the Wall Street Journal shall ever cease to exist or cease to announce a prime or base lending rate, then at the annual rate of interest from time to time announced by Citibank, N.A. (or by any other New York money center bank reasonably selected by City) as its prime or base commercial lending rate, which shall accrue from the dates of the payment of Rent, as the case may be, until paid. 6.3 Right of Offset. City may, at its option and upon written notice to Company, offset any amounts due and payable under this Agreement against any debt (including taxes) lawfully thirty (30) days past due to City from Company and/or any Company Affiliate, regardless of whether the amount due arises pursuant to the terms of this Agreement, a Related Agreement, or otherwise, and regardless of whether or not the debt due City has been reduced to judgment by a court. Article VII Miscellaneous Page 10 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) 7.1 Binding Agreement. The terms and conditions of this Agreement are binding upon the successors and permitted assigns of the Parties hereto. 7.2 Limitation on Liability. It is understood and agreed between the Parties that the Company and City, in satisfying the conditions of this Agreement, have acted independently, and the City assumes no responsibilities or liabilities to third parties in connection with these actions. 7.3 No Joint Venture. It is acknowledged and agreed by the Parties that the terms hereof are not intended to and shall not be deemed to create a partnership or joint venture between the Parties. 7.4 Notice. Any notice required or permitted to be delivered hereunder shall be deemed received three (3) days thereafter sent by United States Mail, postage prepaid, certified mail, return receipt requested, addressed to the Party at the address set forth below or on the day actually received if sent by courier or otherwise hand delivered: If intended for City, to: Attn: City Manager City of Coppell, Texas P. O. Box 478 Coppell, Texas 75019 With a copy to: Peter G. Smith Nichols, Jackson, Dillard, Hager & Smith, L.L.P. 1800 Ross Tower 500 N. Akard Dallas, Texas 75201 If intended for Company: Attn: Raj Akula Northpoint Hotel Group, LLC 768 Lexington Avenue Coppell, Texas 75019 With a copy to: ____________________ 7.5 Authorization. Each Party represents that it has full capacity and authority to grant all rights and assume all obligations that are granted and assumed under this Agreement. 7.6 Severability. In the event any section, subsection, paragraph, sentence, phrase or word herein is held invalid, illegal or unconstitutional, the balance of this Agreement shall stand, shall be enforceable and shall be read as if the Parties intended at all times to delete said invalid section, subsection, paragraph, sentence, phrase or word. 7.7 Governing Law. This Agreement shall be governed by the laws of the State of Texas without regard to any conflict of law rules. Exclusive venue for any action under this Agreement shall be the State District Court of Dallas County, Texas. The Parties agree to submit to the personal and subject matter jurisdiction of said court. 7.8 Counterparts. This Agreement may be executed in any number of counterparts, each of which shall be deemed an original and constitute one and the same instrument. Page 11 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) 7.9 Entire Agreement. This Agreement embodies the complete agreement of the Parties hereto, superseding all oral or written previous and contemporary agreements between the Parties and relating to the matters in this Agreement, and except as otherwise provided herein cannot be modified without written agreement of the Parties to be attached to and made a part of this Agreement. 7.10 Recitals. The determinations recited and declared in the preambles to this Agreement are hereby incorporated herein as part of this Agreement. 7.11 Exhibits. All exhibits to this Agreement are incorporated herein by reference for all purposes wherever reference is made to the same. 7.12 Amendment. This Agreement may only be amended by the mutual written agreement of the Parties. 7.13 Legal Construction. In the event any one or more of the provisions contained in this Agreement shall for any reason be held to be invalid, illegal, or unenforceable in any respect, such invalidity, illegality, or unenforceability shall not affect other provisions, and it is the intention of the Parties to this Agreement that in lieu of each provision that is found to be illegal, invalid, or unenforceable, a provision shall be added to this Agreement which is legal, valid and enforceable and is as similar in terms as possible to the provision found to be illegal, invalid or unenforceable. 7.14 Assignment. This Agreement shall be binding on and inure to the benefit of the parties to it and their respective heirs, executors, administrators, legal representatives, successors, and permitted assigns. This Agreement may not be assigned by the Company without the prior written consent of the City Manager. Notwithstanding the foregoing, the Company, may upon thirty (30) days prior written notice to City, assign this Agreement to an Affiliate in connection with the sale and transfer of the Premises to an Affiliate provided: (i) the Improvements remain subject to an Approved Franchise; and (ii) such assignee executes and delivers to City a written assumption, in a form and substance reasonably approved by City, of all of the obligations of Owner under this Agreement. 7.15 Right of Offset. The City may, at its option, offset any amounts due and payable under this Agreement against any debt (including taxes) lawfully due to the City from the Company, regardless of whether the amount due arises pursuant to the terms of this Agreement or otherwise and regardless of whether or not the debt due the City has been reduced to judgment by a court. 7.16 Employment of Undocumented Workers. During the term of this Agreement, the Company agrees not to knowingly employ any undocumented workers and, if convicted of a violation under 8 U.S.C. Section 1324a (f), the Company shall repay the taxes abated herein, and any other funds received by the Company from the City as of the date of such violation within 120 days after the date the Company is notified by the City of such violation, plus interest at the rate of 4% compounded annually from the date of violation until paid. Page 12 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) (Signature page to follow) Page 13 Civic Center Development Agreement: Aloft City of Coppell and Northpoint Hotel Group, LLC (TM78641) EXECUTED on this _______ day of _____________________, 2018. CITY OF COPPELL, TEXAS By: Mike Land, City Manager ATTEST: By: Christel Pettinos, City Secretary Approved as to Form: By: City Attorney EXECUTED on this _______ day of _____________________, 2018. NORTHPOINT HOTEL GROUP, LLC By: ______________________________ Suketu B. Patel, Manager Page 1 Exhibit “A” to Civic Center Development Agreement: City of Coppell and Chase Hospitality, LLC (TM78613) Exhibit “A” (Legal Description of the Land -- to be attached) Lots 1R2R and 1R3, Block 1 of the Northpoint Addition (5.253 acres) Page 1 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) STATE OF TEXAS § § COUNTY OF DALLAS § CIVIC CENTER AGREEMENT This Civic Center Development Agreement (“Agreement”) is made by and between the City of Coppell, Texas (“City”), and Northpoint Hotel Group, LLC, a Texas limited liability company (the “Company”) (collectively the “Parties,” or singularly as a “Party”), acting by and through their respective authorized officers and representatives. WITNESSETH: WHEREAS, Chapter 351, Tax Code authorizes the City to expend hotel/motel occupancy tax revenue for the acquisition, lease, construction, improvement, enlarging, maintenance, equipping and operation of a convention center facility which includes civic centers, auditoriums, parking areas and auditoriums, owned or managed by the City; and WHEREAS, a Civic Center (hereinafter defined) located in a hotel and conference center located in the City, will enhance and promote tourism and the hotel and convention industry and will attract visitors from outside the City into the City or its vicinity; and WHEREAS, Company owns the land located at 1125 Northpoint, Coppell, Texas, being further described in Exhibit “A” (“Land”), and intends to construct or cause to be constructed thereon a Full Service Hotel (hereinafter defined) containing approximately 69,600 gross square feet of space and containing a minimum of one hundred twenty-five (125) guest rooms (the “Hotel”), and not less than twelve hundred (1,200) gross square feet of meeting space attached to the Hotel (the “Conference Center”), and other ancillary facilities such as reasonably required parking and landscaping more fully described in the submittals filed by Company with the City, from time to time, in order to obtain a building permit(s) (collectively the Hotel and Conference Center referred to as the “Improvements” or as the “Hotel and Conference Center”); and WHEREAS, Company intends to allow the City to use a designated portion of the Conference Center as Civic Center; and WHEREAS, City intends, as lessee of the Conference Center, to contract with the Company to manage and operate the Civic Center for the City; and WHEREAS, City has found and determined that the expenditure of hotel/motel occupancy tax revenue for the lease, operation, and management of the designated portion of the Conference Center, as a Civic Center, is authorized by Chapter 351, Tax Code, and will benefit the City; and WHEREAS, promoting the location of new business enterprises within City will promote economic development, stimulate commercial activity, generate additional sales tax and will enhance the property tax base and economic vitality of City; and Page 2 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) WHEREAS, City has adopted programs for promoting economic development, and this Agreement and the economic development incentives set forth herein are given and provided by City pursuant to and in accordance with those programs; and WHEREAS, the waiver of roadway impact fees and building inspection fees as set forth herein furthers economic development in City and conforms to the programs adopted by City for promoting economic development in City and will enhance the drainage system of the City; and WHEREAS, City is authorized by Article III, Section 52-a of the Texas Constitution and Texas Local Government Code Chapter 380 to provide economic development grants to promote local economic development and to stimulate business and commercial activity in City; and WHEREAS, City has determined that making an economic development grant consisting of the waiver of roadway impact fees and building inspection fees as set forth herein to Company in accordance with City’s economic development program will (i) further the economic development objectives of City; (ii) benefit City and City’s inhabitants; and (iii) promote local economic development and stimulate business and commercial activity in City; and WHEREAS, City Council does hereby approve this Agreement as a program for making an economic development grant to Company for the purpose of stimulating and maintaining its commercial activity within City, and to promote the generation of sales tax, the enhancement of the property tax base, and to maintain and increase the economic vitality of City and to provide for enhancements to the entire City drainage system; NOW THEREFORE, in consideration of the foregoing, and other valuable consideration, the receipt and sufficiency of which is hereby acknowledged, the Parties agree as follows: Article I Findings and Determinations The City Council hereby finds and determines that: (i) City is authorized to enter into this Agreement; (ii) Chapter 351, Tax Code authorizes the expenditure of City hotel/motel occupancy tax revenue for the lease, operation and management of the Conference Center; (iii) the use and management of the Conference Center as a municipal civic center is authorized by Chapter 351, Tax Code and will enhance and promote tourism and the hotel and convention industry and will attract visitors from outside the City into the City or its vicinity; and (iv) the City is authorized to contract for the management of the Conference Center for use as a civic center. Article II Term The term of this Agreement (“Term”) shall commence on the Effective Date and shall continue until the Expiration Date, unless sooner terminated. Article III Page 3 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) Definitions Wherever used in this Agreement, the following terms shall have the meaning ascribed to them unless the context clearly indicates otherwise: “Affiliate” shall mean any entity under the common control or ownership of Company or its parent company. “Approved Franchise” shall mean franchise agreements with Approved Franchisor whereby the Company is permitted to operate the Hotel and Conference Center using the name and reservation system of the Approved Franchisor. “Approved Franchisor” shall mean national or international hotel franchisors, for a specific hotel product, approved by the City; provided, however, that the City shall not unreasonably withhold its consent to a franchisor of a Hotel and Conference Center, and which is one of the five (5) largest national or ten (10) largest international hotel chains as of such date. The City has approved Holiday Inn as the initial Approved Franchisor. “Bankruptcy or Insolvency” shall mean the dissolution or termination of the Party’s existence, insolvency, employment of a receiver for any part of Company’s property and such appointment is not terminated within ninety (90) days after such appointment is initially made, any general assignment for the benefit of creditors or the commencement of any proceedings under any bankruptcy or insolvency laws by or against the Party and such proceedings are not dismissed within ninety (90) days after the filing thereof. “Casualty” shall mean the Improvements are wholly or partially destroyed by fire, earthquake, flood or similar casualty that renders the Improvements unfit for the intended purpose. “City” shall mean the City of Coppell, Texas. “Civic Center” shall mean the use of designated portions of the Conference Center by the City for use as a municipal civic center pursuant to Tax Code Chapter 351 as set forth in Section 5.3. “Commencement Date” shall mean the later of: (i) the date the first final permanent certificate of occupancy is issued by the City for the Hotel and Conference Center; and (ii) the date the Hotel and Conference Center are open for business and serving the citizens of the City and its visitors. “Commencement of Construction” shall mean that: (i) the plans have been prepared and all approvals thereof and permits with respect thereto required by applicable governmental authorities have been obtained for construction of the Improvements; (ii) all necessary permits for the construction of the Improvements on the Land, pursuant to the respective plans therefore having been issued by all applicable governmental authorities; and (iii) grading of the Land or the construction of the vertical elements of the Improvements has commenced. Page 4 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) “Company” shall mean Northpoint Hotel Group, LLC, a Texas limited liability company. “Completion of Construction” shall mean: (i) substantial completion of the Improvements; and (ii) a final certificate of occupancy has been issued for the Company’s occupancy of the Improvements. “Conference Center” shall mean that portion of the Improvements dedicated and used as a full service, upscale, conference center containing not less than twelve hundred (1,200) gross square feet of conference space. “Effective Date” shall mean the last date of execution of this Agreement. “Expiration Date” shall mean the seventh (7th) anniversary date of the Commencement Date. “Force Majeure” shall mean any contingency or cause beyond the reasonable control of a Party including, without limitation, acts of God or the public enemy, war, riot, civil commotion, insurrection, government or de facto governmental action (unless caused by the intentionally wrongful acts or omissions of the Party), fires, explosions or floods, strikes, slowdowns or work stoppages. “Hotel” shall mean a Select Service Hotel containing approximately 69,600 gross square feet of space and containing a minimum of one hundred twenty-five (125) guest rooms. “Hotel Occupancy Tax” or “HOT” shall mean the City’s receipt of tax imposed by the City pursuant to Chapter 351, Tax Code, as amended, on a person who, under a lease, concession, permit, right of access, license, contract or agreement pays for the use or possession or possession of a sleeping room in the Hotel during the calendar year immediately preceding each Rent payment date. “Hotel Tax Report” shall have the same meaning assigned by Tax Code, Chapter 156.151, or if such report is not available then a written certificate or statement authenticated by an appropriate management official of the Company that contains the amount of Hotel Occupancy Tax collected by the Company and paid to the City and to the State Comptroller, or its successor, for the preceding calendar quarter. Such report shall include the total amount of the payments made for sleeping rooms at the Hotel and Conference Center during the preceding reporting period; and the amount of the HOT collected by the Hotel and Conference Center during the preceding reporting period. “Impositions” shall mean all taxes, assessments, use and occupancy taxes, charges, excises, license and permit fees, and other charges by public or governmental authority, general and special, ordinary and extraordinary, foreseen and unforeseen, which are or may be assessed, charged, levied, or imposed by any public or governmental authority on Improvements, the Company, of Company Affiliate, the then owner or operator of the Improvements or any property or any business owned by Company and/or Company Affiliates within the City. Page 5 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) “Improvements” or “Hotel and Conference Center” shall mean collectively, the Hotel and attached Conference Center further described as a Select Service Hotel containing approximately 69,600 gross square feet of space and containing a minimum of one hundred twenty-five (125) guest rooms, and not less than twelve hundred (1,200) gross square feet of meeting space, and other ancillary facilities such as reasonably required parking and landscaping more fully described in the submittals filed by Company with the City, from time to time, in order to obtain a building permit(s). “Land” means the real property described in Exhibit “A”. “Lease Term” mean two (2) consecutive periods of twelve (12) months beginning on the Commencement Date. “Premises” shall mean the Land and the Improvements following construction thereof. “Related Agreement” shall mean any agreement, other than this Agreement, by and between the City and the Company, its parent company, and any affiliated or related entity controlled or owned by Company, or its parent company. “Rent” shall mean for years 1 and 2 of the Lease Term an amount equal to one hundred percent (100%) of the maximum amount allowed by law of the Hotel Occupancy Tax. “Required Use” shall mean the operation of the Hotel and Conference Center, and related amenities, open to the public and serving the adjacent business community and the citizens of the City, under and in accordance with the standards of an Approved Franchise. “Select Service Hotel” shall have the same meaning assigned by the City Comprehensive Zoning Ordinance, as amended. Article IV Hotel and Conference Center 4.1 Construction of Hotel and Conference Center. Company shall, subject to events of Force Majeure, cause Commencement of Construction of the Hotel and Conference Center to occur on or before May 31, 2019; and subject to events of Force Majeure, cause Completion of Construction of Hotel and Conference Center to occur on or before December 31, 2020. 4.2 Inspection/Access. The City, its agents and employees, shall have the right of reasonable access to the Hotel and Conference Center during construction to inspect the Hotel and Conference Center, at reasonable times during normal business hours and with reasonable notice to Company and in accordance with their visitor access and security policies, in order to insure that the construction is in accordance with this Agreement and all applicable state and local laws and regulations (or valid waiver thereof). Page 6 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) 4.3 Casualty and Condemnation. (a) If the Hotel and Conference Center are damaged partially or destroyed by Casualty, regardless of the extent of the damage or destruction, Company shall, subject to events of Force Majeure and the availability of adequate insurance proceeds, within two hundred seventy (270) days from the date of such Casualty commence to repair, reconstruct or replace the damaged or destroyed portion of the Hotel and/or Conference Center, as applicable, and pursue the repair, reconstruction, or replacement with reasonable diligence so as to restore the Hotel and Conference Center to substantially the condition it was in before the Casualty. In the event, Company fails to timely repair, restore or reconstruct the Hotel and Conference Center and complete the same within eighteen (18) months from the date Company commences the restoration work, this Agreement and the City’s obligation to pay any Rent shall terminate. The City shall not be obligated to pay Rent during any period for the repair, restoration or reconstruction of the Hotel and Conference Center. (b) If the Hotel and Conference Center or any material portion thereof is taken for public or quasi-public purposes by condemnation as a result of any action or proceeding in eminent domain, or transferred in lieu of condemnation to any authority entitled to exercise the power of eminent domain, this Agreement and the City’s obligation to pay any Rent shall terminate. 4.4 Required Use. Beginning on the Commencement Date, and continuing thereafter until the Expiration Date, or earlier termination, the Hotel and Conference Center shall not be used for any purpose other than the Required Use and the Company shall not allow the operation of the Hotel and Conference Center in conformance with the Required Use to cease for more than thirty (30) days, except: (i) in connection with and to the extent of an event of Casualty or Force Majeure, and (ii) except in connection with any cessation of not more than ninety (90) days that is due to a change in the Approved Franchisor. Article V Civic Center 5.1 Lease. In consideration of the covenants, agreements and conditions set forth herein, Company does hereby lease, let, demise and rent, for the Lease Term and City does hereby rent and lease from Company for the Lease Term, the Civic Center for the Civic Center Use (as defined in Section 5.3 (b) of this Agreement). 5.2 Rent. (a) Subject to the continued satisfaction of the terms and conditions of this Agreement by the Company and provided the Company has timely caused Commencement and Completion of Construction of the Hotel and Conference Center to occur the City shall, during the Lease Term, pay to Company or to such person or entity as Company shall designate in writing, Rent, for the use and occupancy of the Civic Center, and as consideration for Company’s management of the Civic Center for the City. Rent shall be paid on an annual basis within sixty (60) days after the end of each of the two (2) consecutive twelve (12) month periods following the Commencement Date. Any payment made by the City hereunder is limited to the extent of the lawfully available Page 7 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) funds from the City’s receipts from the collection of the Hotel Occupancy Tax revenue imposed pursuant to Chapter 351, Tax Code attributable to the occupancy of sleeping rooms at the Hotel. (b) The obligation of the City to pay Rent shall be conditioned upon the compliance and satisfaction of the terms and conditions of this Agreement by Company and each of the following: (i) Good Standing. Company shall not have an uncured breach or default of this Agreement or a Related Agreement. (ii) Required Use. During the Term of this Agreement following the Commencement Date and continuing thereafter until the Expiration Date, or earlier termination, the Hotel and Conference Center shall not be used for any purpose other than the Required Use, and that Company shall not allow the use and operation of the Hotel and Conference Center in conformance with the Required Use to cease for more than thirty (30) days, except (i) in connection with, and to the extent of an event of Force Majeure, or (ii) in connection with any cessation of not more than ninety (90) days that is due to a change in the Approved Franchisor. (iii) Hotel Tax Reports. Company shall have timely delivered the Hotel Tax Reports to the City for the applicable calendar year as provided by Section 5.5; and (iv) Receipt of HOT. City shall have received HOT for the applicable calendar year. 5.3 Conditions of Use. (a) Company Exclusive Use. Company shall have exclusive use of the Hotel and Conference Center, except the City may use the Civic Center portion of the Conference Center for Civic Center Use as set forth in this Section 5.3. (b) Civic Center Use. As consideration for the Rent City shall, without charge or expense, be entitled to the use of the main ballroom and the meeting rooms at least six (6) times (each such use not to exceed two (2) consecutive days unless otherwise agreed by the Parties) each calendar year upon ninety (90) days prior written notice, and at additional times as may be agreed by the Parties when available (“Civic Center Use”). All other uses, if any, of the Conference Center by the City shall be at times mutually approved by Company and the City. Any food and beverage, set up, cleaning or other agreed services shall be charged to the City at Company’s direct cost to provide the same. Civic Center Use must conform to the Approved Franchise uses, except that the City is not required to use the food and beverage services of the Hotel and Conference Center during Civic Center Use, and may cater food and beverages during periods of Civic Center Use. (c) Civic Center Standards. Company shall equip and furnish the Civic Center portion of the Conference Center in such manner that it is readily useable by the City as a municipal civic center for the booking of business conventions, meetings, and similar activities. Company shall keep and maintain the Conference Center in a good state of appearance and repair (except for Page 8 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) reasonable wear and tear) at Company’s own expense. City shall be responsible for, and pay for any damages to, the Civic Center and/or the Conference Center, or promptly repair any such damages that occur during the City’s use of the Conference Center. 5.4 Management Duties. The Company shall maintain, manage and operate the Civic Center on behalf of the City. The Company will cause the Civic Center to be operated and maintained according to this Agreement. The Company agrees to provide management services at least equal to those provided for comparable facilities in the DFW Metroplex. 5.5 Hotel Tax Report. Company shall provide, or cause the Hotel Operator to provide, the City with a Hotel Tax Report within thirty (30) days after the end of each calendar month beginning with the thirtieth (30th) day immediately following the last day of the month in which the Commencement Date occurs and continuing thereafter on the thirtieth (30th) day after each calendar month during the Lease Term. The Hotel Tax Report shall be accompanied by a copy of the Hotel and Conference Center report required to be submitted to the Comptroller of the State of Texas, or its successor, pursuant to Texas Tax Code Section 156.151. For purposes of payment of Rent pursuant to this Agreement only and for no other purpose, if the Hotel Tax Report is not submitted within one hundred eighty (180) days after the date the respective report is due, then Company is deemed to have forfeited payment of Rent by the City for the period to which the undelivered report relates. The City shall not be required to pay any Rent for any calendar year during the Lease Term for so long as the City has not received Hotel Occupancy Tax in full for such period. 5.6 Hotel Tax Records. The Company shall keep and maintain accurate records of the Hotel Occupancy Tax collected by the Company and paid to the City, and to the State Comptroller, or successor agency, during the term of this Agreement that is paid by the occupant of each sleeping room in the Improvements. Such records shall include, but not be limited to, at a minimum, guest folios, tax exemption certificates, and any original documents such as posting ledgers and rate and stay adjustment reports. These records may be retained in any retrievable format, including but not limited to micro form; shall be maintained for a period of not less than five (5) years; and shall be available for inspection upon request by any employee, agent, officer or representative of the City at all reasonable times. Any adjustments or allowances made or granted shall be reported to the City on a form prescribed by the City. 5.7 Hotel Records Inspection; Annual Audit. The City shall have the right to audit the books and records of Company pertaining to the operation of the Hotel and Conference Center and any operator thereof during normal business hours upon prior written notice thereof to determine the correctness of the Hotel Tax Reports or the amount of taxes due City and/or State of Texas under Texas Tax Code Chapter 351 and/or 156. Company agrees to pay the cost of an annual audit of the Hotel Tax Records to be performed by an independent party selected by the City. Company shall cause the Hotel Operator to cooperate with the City with any such audit. Article VI Page 9 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) Termination; Repayment 6.1 Termination. This Agreement terminates upon any one or more of the following: (a) by written agreement of the Parties; (b) at 11:59 pm Dallas, Texas, time on the Expiration Date; (c) upon written notice by either Party in the event the other Party breaches any of the terms or conditions of this Agreement or a Related Agreement and such breach is not cured within sixty (60) days after written notice thereof in accordance with this Agreement; (d) upon written notice by the City, if Company suffers an event of Bankruptcy or Insolvency; (e) upon written notice by the City, if any Impositions owed to the City or the State of Texas by Company shall become delinquent after thirty (30) days written notice is delivered pursuant to this Agreement (provided, however, Company retains the right to timely and properly protest and contest any such Impositions); (f) upon written notice by either Party, if any subsequent Federal or State legislation or any decision of a court of competent jurisdiction declares or renders this Agreement in whole, but not in part, invalid, illegal or unenforceable; or (g) upon written notice by either Party, if any decision of a court of competent jurisdiction declares or renders this Agreement invalid, illegal or unenforceable. 6.2 In the event this Agreement is terminated by the City pursuant to Section 6.1 (c), (d), (e), or (f), the City shall be relieved of any further obligation to pay any Rent to the Company and Company shall immediately pay to City an amount equal to the Rent previously paid by City to Company, as of the date of termination, and the amount of the Impact Fee Waiver and Building Inspection fee Waiver, plus interest at the rate periodically announced by the Wall Street Journal as the prime or base commercial lending rate, or if the Wall Street Journal shall ever cease to exist or cease to announce a prime or base lending rate, then at the annual rate of interest from time to time announced by Citibank, N.A. (or by any other New York money center bank reasonably selected by City) as its prime or base commercial lending rate, which shall accrue from the dates of the payment of Rent, as the case may be, until paid. 6.3 Right of Offset. City may, at its option and upon written notice to Company, offset any amounts due and payable under this Agreement against any debt (including taxes) lawfully thirty (30) days past due to City from Company and/or any Company Affiliate, regardless of whether the amount due arises pursuant to the terms of this Agreement, a Related Agreement, or otherwise, and regardless of whether or not the debt due City has been reduced to judgment by a court. Article VII Miscellaneous Page 10 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) 7.1 Binding Agreement. The terms and conditions of this Agreement are binding upon the successors and permitted assigns of the Parties hereto. 7.2 Limitation on Liability. It is understood and agreed between the Parties that the Company and City, in satisfying the conditions of this Agreement, have acted independently, and the City assumes no responsibilities or liabilities to third parties in connection with these actions. 7.3 No Joint Venture. It is acknowledged and agreed by the Parties that the terms hereof are not intended to and shall not be deemed to create a partnership or joint venture between the Parties. 7.4 Notice. Any notice required or permitted to be delivered hereunder shall be deemed received three (3) days thereafter sent by United States Mail, postage prepaid, certified mail, return receipt requested, addressed to the Party at the address set forth below or on the day actually received if sent by courier or otherwise hand delivered: If intended for City, to: Attn: City Manager City of Coppell, Texas P. O. Box 478 Coppell, Texas 75019 With a copy to: Peter G. Smith Nichols, Jackson, Dillard, Hager & Smith, L.L.P. 1800 Ross Tower 500 N. Akard Dallas, Texas 75201 If intended for Company: Attn: Raj Akula Northpoint Hotel Group, LLC 768 Lexington Avenue Coppell, Texas 75019 With a copy to: ____________________ 7.5 Authorization. Each Party represents that it has full capacity and authority to grant all rights and assume all obligations that are granted and assumed under this Agreement. 7.6 Severability. In the event any section, subsection, paragraph, sentence, phrase or word herein is held invalid, illegal or unconstitutional, the balance of this Agreement shall stand, shall be enforceable and shall be read as if the Parties intended at all times to delete said invalid section, subsection, paragraph, sentence, phrase or word. 7.7 Governing Law. This Agreement shall be governed by the laws of the State of Texas without regard to any conflict of law rules. Exclusive venue for any action under this Agreement shall be the State District Court of Dallas County, Texas. The Parties agree to submit to the personal and subject matter jurisdiction of said court. 7.8 Counterparts. This Agreement may be executed in any number of counterparts, each of which shall be deemed an original and constitute one and the same instrument. Page 11 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) 7.9 Entire Agreement. This Agreement embodies the complete agreement of the Parties hereto, superseding all oral or written previous and contemporary agreements between the Parties and relating to the matters in this Agreement, and except as otherwise provided herein cannot be modified without written agreement of the Parties to be attached to and made a part of this Agreement. 7.10 Recitals. The determinations recited and declared in the preambles to this Agreement are hereby incorporated herein as part of this Agreement. 7.11 Exhibits. All exhibits to this Agreement are incorporated herein by reference for all purposes wherever reference is made to the same. 7.12 Amendment. This Agreement may only be amended by the mutual written agreement of the Parties. 7.13 Legal Construction. In the event any one or more of the provisions contained in this Agreement shall for any reason be held to be invalid, illegal, or unenforceable in any respect, such invalidity, illegality, or unenforceability shall not affect other provisions, and it is the intention of the Parties to this Agreement that in lieu of each provision that is found to be illegal, invalid, or unenforceable, a provision shall be added to this Agreement which is legal, valid and enforceable and is as similar in terms as possible to the provision found to be illegal, invalid or unenforceable. 7.14 Assignment. This Agreement shall be binding on and inure to the benefit of the parties to it and their respective heirs, executors, administrators, legal representatives, successors, and permitted assigns. This Agreement may not be assigned by the Company without the prior written consent of the City Manager. Notwithstanding the foregoing, the Company, may upon thirty (30) days prior written notice to City, assign this Agreement to an Affiliate in connection with the sale and transfer of the Premises to an Affiliate provided: (i) the Improvements remain subject to an Approved Franchise; and (ii) such assignee executes and delivers to City a written assumption, in a form and substance reasonably approved by City, of all of the obligations of Owner under this Agreement. 7.15 Right of Offset. The City may, at its option, offset any amounts due and payable under this Agreement against any debt (including taxes) lawfully due to the City from the Company, regardless of whether the amount due arises pursuant to the terms of this Agreement or otherwise and regardless of whether or not the debt due the City has been reduced to judgment by a court. 7.16 Employment of Undocumented Workers. During the term of this Agreement, the Company agrees not to knowingly employ any undocumented workers and, if convicted of a violation under 8 U.S.C. Section 1324a (f), the Company shall repay the taxes abated herein, and any other funds received by the Company from the City as of the date of such violation within 120 days after the date the Company is notified by the City of such violation, plus interest at the rate of 4% compounded annually from the date of violation until paid. Page 12 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) (Signature page to follow) Page 13 Civic Center Development Agreement: Holiday Inn Express City of Coppell and Northpoint Hotel Group, LLC (TM78641) EXECUTED on this _______ day of _____________________, 2018. CITY OF COPPELL, TEXAS By: Mike Land, City Manager ATTEST: By: Christel Pettinos, City Secretary Approved as to Form: By: City Attorney EXECUTED on this _______ day of _____________________, 2018. NORTHPOINT HOTEL GROUP, LLC By: ______________________________ Suketu B. Patel, Manager Page 1 Exhibit “A” to Civic Center Development Agreement: City of Coppell and Chase Hospitality, LLC (TM78613) Exhibit “A” (Legal Description of the Land) Lots 1R2R and 1R3, Block 1 of the Northpoint Addition (5.253 acres) ! !"#$% !"& "# $#% # # '$ "(' )) & # '%# *++$$%"$"& "' ,"-%"'.+$$%"$ !%"$"&" %'"$' " ,/"(%"$.$ "$0'$ , "*'" +$$ /$$"$0 '1'"!$0'$*"!$ '!" ! # (#%# *+& !%"$*% ,*+& -%"'.+$$%"$ !%"$"&, 2 $'( ,%'"$' " ,34/'(" !%"$, '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # )4)'$ "(' -+, '$ "' ,"-%"'.+$$%"$ !%"$"&"%'"$' " , /"(%"$.$ "$0'$ , "*'"+$$ /$$" $0 '1'"!$0'$*"!$ '!" +%% ($'"!$0+$$%"$ !%"$$0'$'.'"!, %$0+0 '"! !%"$-$' " !%"$5 %"$ !%"$% "$($' "%"$ "$%'"$'"!'$$' "0' '$0*'"+$$ /$0'!"'$% $%'"$"'$'"!/"(%"$.$ "$0'$ , "*'"+$$ /$ ! % % 6", $0'!%"$ '. '.7"6"8"'!"$6""( ! $%#&# +$,,( %%" / %# .# 0 1 MEMORANDUM To: Mayor and City Council From: Mindi Hurley, Director of Community Development Date: November 13, 2018 Reference: Consider approval of an Omnibus Settlement Agreement and Release and Termination of Landscape Easement between the City of Coppell and Main Street Coppell, Ltd., et. al., and authorizing the City Manager to sign. 2030: Business Prosperity Executive Summary: The City is purchasing all of Main Street Coppell, Ltd.’s rights, title and interests in the certain rights or options to purchase any remaining real property in the original Development Agreement, Option Agreement, Shared Parking Agreement and Temporary Construction Easement for 0.542 acres of land in Old Town Coppell. Introduction: The City purchased approximately 20 acres of land, which was formerly referred to as the Carter- Crowley fields. City Council wanted to create a place for restaurants, small offices, shopping and a gathering place for residents to enjoy outdoor activities and events. Therefore, on November 29, 2010, the City of Coppell entered into an Option Agreement, Shared Parking Agreement and Development Agreement with CSE Commercial Real Estate to purchase approximately 10.086 acres of land in Old Town Coppell to create a mixed-use center that would become an attractive destination for shopping, eating, working, living and entertainment. That development is the Main Street at Coppell development. The Development Agreement, Shared Parking Agreement and Option Agreement were assigned to Main Street Coppell, Ltd. (MSC) in February 2012. MSC has purchased and developed approximately 9.544 acres of land to date. On September 11, 2018, City Council entered into a Letter of Intent with MSC to purchase all of MSC’s rights, title and interests in the certain rights or options to purchase any remaining real property in the original agreements. Analysis: By executing the Settlement Agreement, the City is being released from the Shared Parking Agreement, Option Agreement, Development Agreement, Temporary Construction Easement and 2 terminating its relationship with Main Street Coppell, Ltd. This agenda item also terminates an existing Landscape Easement between the City of Coppell and Main Street Coppell, Ltd. This agreement will release MSC and the City of Coppell from any obligations, duties and rights listed in the original agreements on the remaining 0.542 acres of land in Old Town Coppell. The City will pay MSC $335,000 to purchase any option or property rights. Legal Review: The documents were created by Bob Hager. Fiscal Impact: $335,000 Recommendation: Community Development recommends approval. 6(77/(0(17$*5((0(17$1'5(/($6(70 67$7(2)7(;$6 &2817<2)'$//$6 201,%866(77/(0(17$*5((0(17 $1'5(/($6( 7KLV6HWWOHPHQW$JUHHPHQWDQG5HOHDVH³$JUHHPHQW´LVPDGHDQGHQWHUHGLQWRE\DQG DPRQJ WKH &LW\ RI &RSSHOO 7H[DV ³&LW\´ &RSSHOO (FRQRPLF 'HYHORSPHQW )RXQGDWLRQ ³&(')´DQG0DLQ6WUHHW&RSSHOO/WG&6(&RPPHUFLDO5HDO(VWDWH/3&KDUOHV&RWWHQDQG *UHJ<DQFH\FROOHFWLYHUHIHUHQFHGDV³'HYHORSHUV´ 5(&,7$/6 :+(5($6 'HYHORSHUV &LW\ DQG &(') KDYH HQWHUHG D VHULHV RI GHYHORSPHQW DJUHHPHQWVRSWLRQDQGDPHQGPHQWVIRUWKHGHYHORSPHQWRI2OG7RZQ$GGLWLRQZLWKLQWKH&LW\ RI&RSSHOOVXFK$JUHHPHQWVDQGDVVLJQPHQWVKHUHLQDIWHUWKH³'HYHORSPHQW$JUHHPHQWV´ZKLFK LQFOXGHWKHIROORZLQJ $'HYHORSPHQW$JUHHPHQW $VVLJQPHQWRI'HYHORSPHQW$JUHHPHQW )LUVW$PHQGPHQWWR'HYHORSPHQW$JUHHPHQW 6HFRQG$PHQGPHQWWR'HYHORSPHQW$JUHHPHQW 7KLUG$PHQGPHQWWR'HYHORSPHQW$JUHHPHQW )RXUWK$PHQGPHQWWR'HYHORSPHQW$JUHHPHQW %2SWLRQ$JUHHPHQW $VVLJQPHQWRI2SWLRQ$JUHHPHQW )LUVW$PHQGPHQWWR2SWLRQ$JUHHPHQW 6HFRQG$PHQGPHQWWR2SWLRQ$JUHHPHQW 7KLUG$PHQGPHQWWR2SWLRQ$JUHHPHQW &6KDUHG3DUNLQJ$JUHHPHQW%HWZHHQ&LW\RI&RSSHOODQG&6(&RPPHUFLDO5HDO (VWDWH/3 )LUVW$PHQGPHQWWR6KDUHG3DUNLQJ$JUHHPHQW%HWZHHQ&LW\RI&RSSHOODQG &6(&RPPHUFLDO5HDO(VWDWH/3 $VVLJQPHQWRI6KDUHG3DUNLQJ$JUHHPHQW '7HPSRUDU\&RQVWUXFWLRQ(DVHPHQW$JUHHPHQW 6(77/(0(17$*5((0(17$1'5(/($6(70 :+(5($6'HYHORSHUV KDYH VXEVWDQWLDOO\ SHUIRUPHG DOO REOLJDWLRQV XQGHU WKH 'HYHORSPHQW $JUHHPHQWV DQG QRZ GHVLUHWR WHUPLQDWH WKH 'HYHORSPHQW $JUHHPHQWV DQG WR UHOHDVHDQ\UHPDLQLQJULJKWVREOLJDWLRQVDQGGXWLHVXQGHUVXFK'HYHORSPHQW$JUHHPHQWVDQG :+(5($6WKH&LW\DQG&(')GHVLUHVWRDFNQRZOHGJHFRPSOHWLRQRIWKHREOLJDWLRQVRI WKH'HYHORSHUVXQGHUWKH'HYHORSPHQW$JUHHPHQWVWHUPLQDWHWKH'HYHORSPHQW$JUHHPHQWVDQG UHOHDVH DQ\ UHPDLQLQJ ULJKWV REOLJDWLRQV DQG GXWLHV RI 'HYHORSHUV XQGHU VDLG 'HYHORSPHQW $JUHHPHQWVDQG :+(5($6WKH&LW\DQG&(')QRZVHHNWRUHSXUFKDVHDQ\RXWVWDQGLQJRSWLRQVGXWLHV FRPPLWPHQWVDQGFRQFOXGHDOOFRQWUDFWXDOREOLJDWLRQVRIDQ\NLQGRUQDWXUHEHWZHHQDOOWKH UHVSHFWLYHSDUWLHVLQWKLV$JUHHPHQWDQG :+(5($6WKH&LW\&(')DQG'HYHORSHUVGRKHUHE\DJUHHDVKHUHLQDIWHUVHWIRUWK 12: 7+(5()25( IRU DQG LQ FRQVLGHUDWLRQ RI WKH UHFLWDOV VHW IRUWK DERYH WKH FRYHQDQWVWHUPVFRQGLWLRQVDQGUHOHDVHVKHUHLQFRQWDLQHGWKHUHFHLSWDQGVXIILFLHQF\RIZKLFK DUHKHUHE\DFNQRZOHGJHGWKH3DUWLHVZDUUDQWUHSUHVHQWDQGDJUHHWRWKHIROORZLQJWHUPV ,$*5((0(17$1'3$<0(17 7KDW'HYHORSHUVLQGLYLGXDOO\FROOHFWLYHO\DQGWRJHWKHUDJUHHWRUHOHDVHWKH&LW\ DQG&(')IURPDQ\ULJKWWLWOHLQWHUHVWRSWLRQVFRQWUDFWXDOGXWLHVRUREOLJDWLRQVXQGHUDQ\RIWKH 'HYHORSPHQW$JUHHPHQWVUHFLWHGKHUHLQVXEMHFWWRWKLV$JUHHPHQWDQGWKH&LW\DQG&(') LQGLYLGXDOO\ FROOHFWLYHO\ DQG WRJHWKHU DJUHH WR UHOHDVH WKH 'HYHORSHUV IURP DQ\ GXWLHV RU REOLJDWLRQVXQGHUWKH'HYHORSPHQW$JUHHPHQWV ,QH[FKDQJHWKHUHIRUHWKH&LW\DJUHHVWRSD\LQFHUWLILHGIXQGVWKHVXPRI7KUHH +XQGUHG7KLUW\)LYH7KRXVDQG'ROODUVWR0DLQ6WUHHW&RSSHOO/WGDVIXOODQGILQDO FRPSHQVDWLRQIRUUHOHDVHE\WKH'HYHORSHUVDQGZKLFKLQFOXGHVDQ\DQGDOOFRQWUDFWXDOULJKWVWLWOH RULQWHUHVWWRUHDORUSHUVRQDOSURSHUW\LQFOXGLQJDQ\FKRVHLQDFWLRQDQ\DPRXQWIRUORVVSURILWRU GDPDJHVLIDQ\XQGHUWKH'HYHORSPHQW$JUHHPHQWV:LWKLQWKUHHEXVLQHVVGD\VIROORZLQJWKH IXOOH[HFXWLRQRIWKLV$JUHHPHQWWKH&LW\VKDOOSD\WKHUHTXLUHGIXQGVDVSURYLGHGKHUHLQYLDD ZLUHWUDQVIHURIIXQGVLQDFFRUGDQFHZLWKWKHZLULQJLQVWUXFWLRQVDWWDFKHGKHUHWRDV([KLELW$7KH &(')VKDOOUHWDLQWKHEDODQFHRIWKH2SWLRQ)HHSDLGSXUVXDQWWRWKH2SWLRQ$JUHHPHQW ,,0878$/5(/($6( ,QFRQVLGHUDWLRQRIDOORIWKHQDPHG3DUWLHVDQGDOORIWKHLUUHVSHFWLYHDIILOLDWHVRU DVVLJQVKROGLQJDQ\LQWHUHVWZKDWVRHYHULQWKH'HYHORSPHQW$JUHHPHQWVRURSWLRQVGRKHUHE\ UHOHDVHDQGKROGKDUPOHVVWKH&LW\RI&RSSHOO7H[DV&(')'HYHORSHUVDQGWKHLUUHVSHFWLYH HPSOR\HHVDJHQWVRIILFLDOVRIILFHUVFRQWUDFWRUVDJHQWVUHSUHVHQWDWLYHVDQGRUDIILOLDWHVIURPDQ\ DQGDOOOLDELOLW\GDPDJHVFODLPVVXLWVFRVWVLQFOXGLQJFRXUWFRVWVUHODWHGWRWKH'HYHORSPHQW 6(77/(0(17$*5((0(17$1'5(/($6(70 $JUHHPHQWV DQG WKH 2OG 7RZQ $GGLWLRQ ZKHWKHU ZULWWHQ RU RUDO RU RWKHUZLVH DVVHUWHG RU XQDVVHUWHGUHDORUSHUVRQDOWKDWWKHSDUWLHVPD\KDYH %\WKHH[HFXWLRQRIWKLV$JUHHPHQWWKH3DUWLHVKHUHE\DFNQRZOHGJHSHUIRUPDQFH RIDOOWKHGXWLHVDQGREOLJDWLRQVFRQWDLQHGLQ6HFWLRQDQGRIWKLV$JUHHPHQW7KH3DUWLHVIXUWKHU DJUHHWKDWWKLVZLOOEHDIXOODQGILQDOVHWWOHPHQWRIDOOFODLPVDVUHFLWHGKHUHLQXSRQPXWXDO H[HFXWLRQRIWKH$JUHHPHQW ,,,:$55$17< 7KH3DUWLHVUHSUHVHQWDQGZDUUDQWWKDWWKH\KDYHQRWDVVLJQHGRUWUDQVIHUUHGDQ\ SRUWLRQRIDQ\LQWHUHVWFODLPGHPDQGDFWLRQRUFDXVHRIDFWLRQWKDWPD\DULVHIURPRULQDQ\ZD\ UHODWH XQGHU WKH 'HYHORSPHQW $JUHHPHQWV DQG WKLV $JUHHPHQW WKH 3URSHUW\ RU HDVHPHQW WHPSRUDU\FRQVWUXFWLRQHDVHPHQWSURYLGHGKHUHLQWRDQ\SHUVRQILUPRUFRUSRUDWLRQ 7KH3DUWLHVUHSUHVHQWDQGZDUUDQWWKDWWKH\DUHWKHIXOODQGVROHRZQHUVRIWKH 3URSHUW\FODLPVGHPDQGVDFWLRQVRUFDXVHVRIDFWLRQDULVLQJIURPRULQDQ\ZD\UHODWLQJWRWKH FLUFXPVWDQFHVDQGFRQGLWLRQVPDGHWKHEDVLVRIWKLV$JUHHPHQW ,935,25$*5((0(176 7KLV $JUHHPHQW VXSHUVHGHV DQ\ SULRU FRQWHPSRUDQHRXV RU VXEVHTXHQW RUDO DJUHHPHQWVRUXQGHUVWDQGLQJVRIWKH3DUWLHVDQGVKDOOEHELQGLQJXSRQDQGLQXUHWRWKHEHQHILWRI WKHH[HFXWRUVDGPLQLVWUDWRUVSHUVRQDOUHSUHVHQWDWLYHVKHLUVVXFFHVVRUVDQGDVVLJQVRIWKH3DUWLHV DQGWKH3URSHUW\1RYDULDWLRQVDPHQGPHQWVPRGLILFDWLRQVRUFKDQJHVWRWKLV$JUHHPHQWVKDOO EHELQGLQJXSRQDQ\RIWKH3DUWLHVXQOHVVLQZULWLQJDQGGXO\DQGIXOO\H[HFXWHGE\DOO3DUWLHV 7KH 3DUWLHV DJUHH WKDW WKLV $JUHHPHQW FRQWDLQV WKH LQWHJUDWHG ZKROH RI DOO DJUHHPHQWV DQG XQGHUVWDQGLQJVEHWZHHQWKH3DUWLHV 9$66,*10(17 6KDUHG3DUNLQJ,QDGGLWLRQDQGLQIXUWKHUFRQVLGHUDWLRQIRUWKHSD\PHQWSURYLGH KHUHLQWKH'HYHORSHUVKHUHE\DVVLJQDQGTXLWFODLPWRWKH&LW\DQG&(')DQ\ULJKWVDJUHHPHQWV RUGXWLHVXQGHUWKH6KDUHG3DUNLQJ$JUHHPHQWVDVDPHQGHGDQGWKLV$JUHHPHQWVKDOOFRQVWLWXWH DQDVVLJQPHQWRIDQ\ULJKWWLWOHRULQWHUHVWRI'HYHORSHURIVDLG$JUHHPHQWVVXEMHFWWRDQ\ 2UGLQDQFHRU3ODQQHG'HYHORSPHQW=RQLQJUHTXLUHPHQWVIRU3'$DQG+LVWRULFDO 'LVWULFW=RQLQJUHJXODWLRQVZKLFKJRYHUQSDUNLQJZLWKLQWKH2OG7RZQ'HYHORSPHQWDQGRU 'LVWULFWDVDPHQGHG $GGLWLRQRI3URSHUW\WR'HFODUDWLRQ5HIHUHQFHLVPDGHWRWKDWFHUWDLQ'HFODUDWLRQ RI&RYHQDQWV&RQGLWLRQVDQG5HVWULFWLRQVIRU0DLQ6WUHHW&RSSHOOGDWHG0D\UHFRUGHG DV'RFXPHQW1XPEHULQWKH2IILFLDO3XEOLF5HFRUGVRI'DOODV&RXQW\7H[DVDV DPHQGHGWKH³'HFODUDWLRQ´3ULRUWRWKHFRQYH\DQFHWRDWKLUGSDUW\QRWDIILOLDWHGZLWKWKH&LW\ D³%X\HU´RIHLWKHURUERWKRIWKHORWVGHVFULEHGDV/RW5%ORFN'DQG/RW5%ORFN(RIWKH 6(77/(0(17$*5((0(17$1'5(/($6(70 5HSODWRI/RWV55%ORFN$/RWV5;DQG5%ORFN%/RWV55%ORFN&/RWV55%ORFN' /RWV55DQG5%ORFN(2/'72:1$'',7,21DQGD5HSODWRI/RW%ORFN$/RW%ORFN% /RW%ORFN&/RW%ORFN'DQG/RWDQG/RW%ORFN(2/'72:1$'',7,21DQ$GGLWLRQWR WKH&LW\RI&RSSHOO'DOODV&RXQW\7H[DVDFFRUGLQJWRWKH3ODWWKHUHRIUHFRUGHGLQFF 5HDO3URSHUW\5HFRUGV'DOODV&RXQW\7H[DVWKH&LW\VKDOOVXEPLWWKHORWVEHLQJFRQYH\HGIRU DGGLWLRQWRWKH'HFODUDWLRQSXUVXDQWWR6HFWLRQERIWKH'HFODUDWLRQ2WKHUWKDQDVSURYLGHG LQWKHSUHFHGLQJVHQWHQFHWKH&LW\VKDOOKDYHQRREOLJDWLRQWRFDXVHWKHORWVWREHDGGHGWRWKH 'HFODUDWLRQDQGVXFKGHFLVLRQVKDOOEHGHWHUPLQHGE\YRWHRIWKH$VVRFLDWLRQDVGHVFULEHGLQWKH 'HFODUDWLRQ 9,0,6&(//$1(286 ,W LV H[SUHVVO\ XQGHUVWRRG DQG DJUHHG WKDW WKH WHUPV RIWKLV $JUHHPHQW DUH FRQWUDFWXDOLQQDWXUHDQGQRWPHUHUHFLWDOVDQGWKDWWKHDJUHHPHQWVFRQWDLQHGKHUHLQDQGWKH FRQVLGHUDWLRQWUDQVIHUUHGDUHWRFRPSURPLVHGRXEWIXODQGGLVSXWHGFODLPVDQGWKLV$JUHHPHQWLV EHLQJHQWHUHGLQWRWRDYRLGOLWLJDWLRQDQGDQ\IXUWKHUGLVSXWHRUFODLPVDQGWREX\SHDFHWRWKH H[WHQWGHVFULEHGKHUHLQ 7KH3DUWLHVVWDWHWKDWWKH\KDYHFDUHIXOO\UHDGWKHIRUHJRLQJ$JUHHPHQWWKDWWKH\ NQRZWKHFRQWHQWVWKHUHRIWKDWWKH\KDYHKDGWKHRSSRUWXQLW\WRFRQVXOWZLWKDQDWWRUQH\UHJDUGLQJ WKHPHDQLQJDQGHIIHFWWKHUHRIDQGWKDWWKH\KDYHVLJQHGVDLG$JUHHPHQWDVWKHLURZQIUHHDFWDQG GHHG 7KLV$JUHHPHQWFDQQRWEHDOWHUHGPRGLILHGZDLYHGRUDPHQGHGLQZKROHRULQ SDUWH[FHSWLQZULWLQJVLJQHGE\DOO3DUWLHV 6KRXOGDQ\WHUPRUSURYLVLRQRIWKLV$JUHHPHQWEHGHFODUHGLQYDOLGE\DQ\FRXUW RIFRPSHWHQWMXULVGLFWLRQWKH3DUWLHVLQWHQGWKDWDOORWKHUWHUPVRIWKLV$JUHHPHQWVKDOOEHYDOLG DQGELQGLQJDQGKDYHIXOOIRUFHDQGHIIHFWDVLIWKHLQYDOLGSRUWLRQKDGQRWEHHQLQFOXGHGKHUHLQ $OODWWRUQH\V¶IHHVDQGRWKHUFRVWVDVVRFLDWHGZLWKWKLVPDWWHUZLOOEHERUQHE\WKH 3DUW\LQFXUULQJVDPH 7KH$JUHHPHQWVKDOOEHJRYHUQHGE\WKHODZVRIWKH6WDWHRI7H[DVDQGYHQXHIRU DQ\DFWLRQFRQFHUQLQJWKLV$JUHHPHQWVKDOOEHLQWKH6WDWH'LVWULFW&RXUWRI'DOODV&RXQW\7H[DV 7KH3DUWLHVDJUHHWRVXEPLWWRWKHSHUVRQDODQGVXEMHFWPDWWHUMXULVGLFWLRQRIVDLGFRXUW 7KLV$JUHHPHQWZLOOEHFRPHHIIHFWLYHRQWKHGDWHVLJQHGE\WKHODVWRIWKHSDUWLHV KHUHWRWRVLJQ $OOH[KLELWVWRWKLV$JUHHPHQWDUHLQFRUSRUDWHGKHUHLQE\UHIHUHQFHIRUDOOSXUSRVHV ZKHUHYHUUHIHUHQFHLVPDGHWRWKHVDPH 6(77/(0(17$*5((0(17$1'5(/($6(70 $Q\RIWKHUHSUHVHQWDWLRQVZDUUDQWLHVFRYHQDQWVDQGREOLJDWLRQVRIWKHSDUWLHVDV ZHOO DV DQ\ ULJKWV DQG EHQHILWV RI WKH SDUWLHV SHUWDLQLQJ WR D SHULRG RI WLPH IROORZLQJ WKH WHUPLQDWLRQRIWKLV$JUHHPHQWVKDOOVXUYLYHWHUPLQDWLRQ 7KLV$JUHHPHQWPD\EHH[HFXWHGLQPXOWLSOHFRXQWHUSDUWVHDFKRIZKLFKVKDOOEH GHHPHGDQRULJLQDO [Signature Page to Follow] 6(77/(0(17$*5((0(17$1'5(/($6(70 (;(&87('WKLVWKHBBBBGD\RIBBBBBBBBB %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 0LNH/DQG&LW\0DQDJHU&LW\RI&RSSHOO7H[DV (;(&87('WKLVWKHBBBBGD\RIBBBBBBBBB %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB BBBBBBBBBBBBBBBBBBBB3UHVLGHQW &RSSHOO(FRQRPLF'HYHORSPHQW)RXQGDWLRQ (;(&87('WKLVWKHBBBBGD\RIBBBBBBBBB %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &KDUOHV&RWWHQ0DQDJHU&6(3URYLGHQW//& *HQHUDO3DUWQHURI0DLQ6WUHHW&RSSHOO/WG (;(&87('WKLVWKHBBBBGD\RIBBBBBBBBB %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &KDUOHV&RWWHQ0DQDJHU'HEFR3DUWQHUV//& *HQHUDO3DUWQHURI&6(&RPPHUFLDO5HDO(VWDWH/3 (;(&87('WKLVWKHBBBBGD\RIBBBBBBBBB %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &KDUOHV&RWWHQ (;(&87('WKLVWKHBBBBGD\RIBBBBBBBBB %\BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB *UHJ<DQFH\ 6(77/(0(17$*5((0(17$1'5(/($6(70 $&.12:/('*(0(176 67$7(2)7(;$6 &2817<2)'$//$6 $FNQRZOHGJHGEHIRUHPHRQWKHBBBBBGD\BBBBBE\0LNH/DQG&LW\0DQDJHU &LW\RI&RSSHOOD7H[DVKRPHUXOHPXQLFLSDOLW\IRUDQGRQEHKDOIRIVDLGPXQLFLSDOLW\ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1RWDU\3XEOLF6WDWHRI7H[DV 0\FRPPLVVLRQH[SLUHVBBBBBBBBBBBBBBB 67$7(2)7(;$6 &2817<2)'$//$6 $FNQRZOHGJHG EHIRUH PH RQ WKH BBBBB GD\ RI BBBBBBBB E\BBBBBBBBBBBB 3UHVLGHQWRIWKH&RSSHOO(FRQRPLF'HYHORSPHQW)RXQGDWLRQ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1RWDU\3XEOLF6WDWHRI7H[DV 0\FRPPLVVLRQH[SLUHVBBBBBBBBBBBBBBB 67$7(2)7(;$6 &2817<2)'$//$6 $FNQRZOHGJHG EHIRUH PH RQ WKH BBBBB GD\ RI BBBBBBBB E\&KDUOHV &RWWHQ PDQDJHURI&6(3URYLGHQW//&D7H[DVOLPLWHGOLDELOLW\FRPSDQ\JHQHUDOSDUWQHURI0DLQ6WUHHW &RSSHOO/WGD7H[DVOLPLWHGSDUWQHUVKLSRQEHKDOIRIVXFKOLPLWHGOLDELOLW\FRPSDQ\DQGOLPLWHG SDUWQHUVKLS BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1RWDU\3XEOLF6WDWHRI7H[DV 0\FRPPLVVLRQH[SLUHVBBBBBBBBBBBBBBB 6(77/(0(17$*5((0(17$1'5(/($6(70 67$7(2)7(;$6 &2817<2)'$//$6 $FNQRZOHGJHG EHIRUH PH RQ WKH BBBBB GD\ RI BBBBBBBB E\&KDUOHV &RWWHQ PHPEHURI'HEFR3DUWQHUV//&D7H[DVOLPLWHGOLDELOLW\FRPSDQ\JHQHUDOSDUWQHURI&6( &RPPHUFLDO5HDO(VWDWH/3D7H[DVOLPLWHGSDUWQHUVKLSRQEHKDOIRIVXFKOLPLWHGOLDELOLW\ FRPSDQ\DQGOLPLWHGSDUWQHUVKLS BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1RWDU\3XEOLF6WDWHRI7H[DV 0\FRPPLVVLRQH[SLUHVBBBBBBBBBBBBBBB 67$7(2)7(;$6 &2817<2)'$//$6 $FNQRZOHGJHG EHIRUH PH RQ WKH BBBBB GD\ RI BBBBBBBB E\&KDUOHV &RWWHQ ,QGLYLGXDOO\ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1RWDU\3XEOLF6WDWHRI7H[DV 0\FRPPLVVLRQH[SLUHVBBBBBBBBBBBBBBB 67$7(2)7(;$6 &2817<2)'$//$6 $FNQRZOHGJHGEHIRUHPHRQWKHBBBBGD\RIBBBBBE\*UHJ<DQFH\,QGLYLGXDOO\ BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB 1RWDU\3XEOLF6WDWHRI7H[DV 0\FRPPLVVLRQH[SLUHVBBBBBBBBBBBBBBB 6(77/(0(17$*5((0(17$1'5(/($6(70 (;+,%,7$ >6HH$WWDFKHG@ &LW\RI&RSSHOO 3DUNZD\%OYG &RSSHOO7H[DV BBBBBBBBBBBBBBBBBBB 0DLQ6WUHHW&RSSHOO3URSHUW\2ZQHUV$VVRFLDWLRQ,QF FR0DLQ6WUHHW&RSSHOO/WG 12¶&RQQRU5G ,UYLQJ7; 5H /LFHQVH$JUHHPHQWGDWHG-XQHEHWZHHQ&LW\RI&RSSHOO³&LW\´DQG0DLQ 6WUHHW&RSSHOO3URSHUW\2ZQHUV$VVRFLDWLRQ,QFWKH³32$´WKH³$JUHHPHQW´ /DGLHVDQG*HQWOHPHQ 3XUVXDQWWR6HFWLRQFRIWKH$JUHHPHQW&LW\KHUHE\HOHFWVWRLPPHGLDWHO\WHUPLQDWH WKH$JUHHPHQWDQGWRUHOHDVHWKH32$IURPWKH$JUHHPHQWDQGDQ\REOLJDWLRQWRFRQWLQXH PDLQWDLQLQJWKH3HUPLWWHG,PSURYHPHQWVUHIHUHQFHGLQWKH$JUHHPHQW$VDJUHHGWRLQ6HFWLRQ RIWKH$JUHHPHQW&LW\ZLOOFRQWLQXHWRPDLQWDLQWKH3HUPLWWHG,PSURYHPHQWVFXUUHQWO\LQSODFH IRUQROHVVWKDQWHQ\HDUVKHUHDIWHUVXEMHFWKRZHYHUWRWKHULJKWRI&LW\WRUHPRYHRUPDNH FKDQJHVWRWKH3HUPLWWHG,PSURYHPHQWVWRDFFRPPRGDWHRWKHU&LW\XVHVIRUSXEOLFSXUSRVHV ,I\RXKDYHDQ\TXHVWLRQVSOHDVHFRQWDFWWKHXQGHUVLJQHG 6LQFHUHO\ &,7<2)&233(// %\ 0LNH/DQG&LW\0DQDJHU FF -HIIUH\)LQN $SSOH )LQN//3 3OD]D%OYG6WH &RSSHOO7; MILQN#DSSOHILQNODZFRP ! " !"#$%& !"#' #$ %$& $ $ #"(#(#" )) ' $ (&$ * %+, #( -* % .#"+, (%./%(#" #%0%( # &#(##& #% -12 2#%. (3(#"%.(% 4#"% ("##0 0&#% " $ )$&$ ! * %+,&& -* %5#(# 0 +,-* %$#%. %0 +,-* %.#"+-* % 6(#+($#+,'#"(#- (&*$ )$&$ +$, ! $& )&- ! ! + .,- (&$ % %$ ! ! ! "$ ! (&$, /' # $ ) )(% #0( .,- (% #( -* % .#"+, (%./%(#" #%0%( # &#(##& #% -12 2#%. (3(#"%.(%4#"% ("##0 0&#% /&& & & .-(0(&0% -%.("#(%&(12 2 (- (#$#$4* " %&$'$ .#"(#(#"7%&#%0 &&# -.#"+, (%./%(#" #%0%( # &# !" 0 &$ "$ 0-$$ 1 MEMORANDUM To: Mayor and City Council From: Kent Collins, P.E., Director of Public Works Date: November 13, 2018 Reference: Freeport Parkway Reconstruction CO#1 2030: Sustainable City Government, Goal 3 Excellent and Well-maintained City Infrastructure and Facilities General Information: x Freeport Parkway reconstruction scope includes full pavement replacement, bridge reconstruction, utility replacement/rehabilitation, landscaping enhancement, geometry improvements, trail construction, lighting, and a new traffic signal. x Texas Sterling Construction Company’s original contract price was $15,819,808.64 x Construction began Summer 2018 with an estimated completion time of 18 months x Change Order #1 adds: a) 12,516 LF of 12” Edge Drain to mitigate excess irrigation water from running under the paving surface and deteriorating the new street; b) replacement of two failed inlet throats on Southwestern; and c) replacement of the water line tie in on Southwestern and the addition of contract 28 days to cover the additional scope. x The new Contract Amount with Change Order #1 will be $15,976,042.90. Introduction: This agenda item is being presented to consider approval of Change Order #1 with Texas Sterling Construction Company, in an amount of $156,234.26. The scope of the change order is to install edge drain along both curbs, replace two inlet throats, and a change in water line pipe connection from what was originally designed, due to a condition change. Analysis: The Freeport Parkway Reconstruction Project limits begin at Dividend/IH-635 and end at Bethel Road. This segment of Freeport Parkway was originally constructed in two phases in 1981 (Bethel to Airline) and 1986 (Airline to IH-635). This contract modification is necessary via change order, as it was discovered during the demolition of the existing roadway that there was excessive 2 moisture content in the soil beneath the existing roadway that was leading to subgrade failure and translating through the concrete as street failures. Based on the topography and existing development, it is believed that much of this water is due to irrigation of the properties along Freeport. To mitigate this problem on the new roadway, it was recommended by the Engineer to install a 12” Edge Drain along both the North and Southbound outside edges of the road for the full length of the construction zone. This should allow water to drain properly without running under the road and damaging the subgrade, which would in-turn quickly deteriorate the new road. The cost for this change is $123,508.96. The second item included in this change order involves replacing two inlet throats. During the pavement demolition on Southwestern to install the water line beneath the street, it was noted that these two inlet throats had failed and needed to be replaced to allow storm water to flow to the inlets properly. The value of this change is $3,210.96. Last, as-built drawings on Southwestern showed an incorrect tie in configuration at Water Line “O”. In order to make this connection, the existing incorrect pipe connection of a 24” 90-degree “L” needs to be removed and replaced with a 24” Flange Tee at the tie in point. The value of this change is $29,514.34. The total value of the proposed change order is $156,234.26 and will add an additional 28 days to the contract time. Project completion is currently expected in Spring of 2020. Legal Review: Standard City bidding documents were utilized for this project and have been reviewed by the City Attorney. Fiscal Impact: The fiscal impact of this agenda item is $156,234.26 as provided for in CIP and IMF. Recommendation: The Engineering Department recommends approval of Change Order #1 with Texas Sterling Construction Company. TSC#:1723Item4"UnderdrainName:FreeportParkwayQuantity12,516Job#:ST15Ͳ01AUnitsLF Unit/Shift 481Control:0Owner:CityofCoppell#ofShifts26Hours/Shift10Burden55%0.5 EA 130 $38.00 $20.90 $7,657.001 EA 260 $22.00 $12.10 $8,866.002 EA 520 $15.00 $8.25 $12,090.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.00$18,460.00 $10,153.00 $28,613.000.5 EA 130 $10.00 $1,300.001 EA 260 $39.04 $10,150.401 DAY 26 $115.00 $2,990.000$0.000$0.000$0.000$0.000$0.000$0.00$14,440.40 $14,440.4013,000 LF $4.95 $64,350.00$0.00$0.0024 HR$55.00 $1,320.00$0.00$0.00$0.00$0.00$0.00$64,350.00 $1,320.00 $0.00 $65,670.00Labor Burden Equipment Materials Subcontractor Misc. $108,723.4015%15% 15% 15% 15%$2,769.00 $2,166.06 $9,652.50 $198.00 $0.00 $14,785.56$21,229.00 $10,153.00 $16,606.46 $74,002.50 $1,518.00 $0.00 $123,508.96UnitRate$9.87Quantity Unit LaborRateTotalHoursDescriptionLaborForemanOperatorEquipmentLaborEquipmentRateMaterialRate Subcontractor Misc. TotalForemanPickup12"EdgeDrainCAT416FBackhoeJumpingJackCompactor%MarkupMarkupAmountTotalsSubtotalsSubtotalsSubtotalsMaterials&SubcontractorsTandemAxleDumpTruck$123,508.96Totals TSC#:1723Name:FreeportParkwayJob#:ST15Ͳ01AControl:Owner:CityofCoppellItem Description Units OriginalQty COQuantity RevisedQty Rate COAmount1InletThroatsonSouthwestern EA 2 2 $1,605.48 $3,210.960 0 0 0 $0.00 $0.00CͲ73 PermReinf.Conc.PavementRepair SY 797 700 1497 $116.00 $81,200.000 0 0 0 $0.00 $0.000 0 0 0 $0.00 $0.000 0 0 0 $0.00 $0.000 0 0 0 $0.00 $0.000 0 0 0 $0.00 $0.000 0 0 0 $0.00 $0.000 0 0 0 $0.00 $0.00TotalAmount$84,410.96TwoexistinginletswillneedtohavethethroatsremovedandreplacedItemCͲ73isforanadditional350'x18'sectionasrequested1InletThroatsonSouthwestern EA 22$1,605.48$3,210.96 TSC#:1723ItemInletThroatsonSouthwesternName:FreeportParkwayQuantity2Job#:ST15Ͳ01AUnitsEAControl:0Owner:CityofCoppell#ofShifts1Hours/Shift10Burden55%0.25 EA 2.5 $38.00 $20.90$147.251 EA 10 $22.00 $12.10$341.002 EA 20 $16.00 $8.80$496.002 EA 20 $16.00 $8.80$496.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.00$955.00 $525.25 $1,480.250.5 EA 5 $10.00 $50.001 EA 10 $39.04 $390.400$0.000$0.000$0.000$0.000$0.000$0.000$0.00$440.40 $440.402 EA $50.00 $100.006 CY $118.00 $708.002 LD $30.00 $60.00200 LB $0.36 $72.00$0.00$0.00$0.00$0.00$0.00$940.00 $0.00 $0.00 $940.00Labor Burden Equipment Materials Subcontractor Misc. $2,860.6515%15% 15% 15% 15%$143.25 $66.06 $141.00 $0.00 $0.00 $350.31$1,098.25 $525.25 $506.46 $1,081.00 $0.00 $0.00 $3,210.96UnitRate$1,605.48Quantity Unit LaborRateTotalHoursDescriptionLaborForemanOperatorEquipmentFormsetterConcreteFinisherEquipmentRateMaterialRate Subcontractor Misc. TotalForemanPickupFormMaterialCAT416FBackhoe%MarkupMarkupAmountTotalsSubtotalsSubtotalsSubtotalsMaterials&SubcontractorsConcreteͲClassCConcreteͲDeliveryFeeRebar TSC#:1723Name:FreeportParkwayJob#:ST15Ͳ01AControl:Owner:CityofCoppellItem Description Units OriginalQty COQuantity RevisedQty Rate COAmount0 0 $0.00 $0.001 WaterLineOTieIn EA 0 1 1 $29,514.34 $29,514.340 0 0 $0.00 $0.000 0 0 0 $0.00 $0.00TotalAmount$29,514.34 TSC#:1723ItemWaterLineOTieInName:FreeportParkwayQuantity1Job#:ST15Ͳ01AUnitsEA Unit/Shift 1.000Control:0Owner:CityofCoppell#ofShifts1Hours/Shift10Burden55%1 EA 10 $45.72 $25.15$708.661 EA 10 $22.50 $12.38$348.752 EA 20 $16.25 $8.94$503.750.5 EA 5 $19.00 $10.45$147.250 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.000 $0.00$0.00$1,102.20 $606.21 $1,708.4100 $0.00 $0.000.5 EA 5 $98.93 $494.651 EA 10 $105.93 $1,059.300.5 EA 5 $23.33 $116.651 EA 10 $20.47 $204.700$0.000$0.000$0.000$0.00$1,875.30 $1,875.30$0.001EA$22,160.00 $22,160.00$0.00$0.00$0.00$0.00$0.00$0.00$0.00$0.00 $22,160.00 $0.00 $22,160.00Labor Burden Equipment Materials Subcontractor Misc. $25,743.7115%15% 15% 15% 15%$165.33 $281.30 $0.00 $3,324.00 $0.00 $3,770.63$1,267.53 $606.21 $2,156.60 $0.00 $25,484.00 $0.00 $29,514.34UnitRate$29,514.34MarkupAmountTotalsSubtotals%MarkupMaterials&SubcontractorsRangelineͲRushQuoteSubtotalsCAT938MLoaderCAT320CLGMC2500PickupDoosanC185WDZͲT4FAirCompressorSubtotalsOperatorͲExcavatorLaborͲPipelayerOperatorͲLoaderEquipmentMaterialRate Subcontractor Misc. TotalLaborLaborRateEquipmentRateForemanDescriptionQuantity UnitTotalHours 6%(&HUWLILHG&RQWUDFWRU Rangeline Pipeline Services, LLC. Main Office (682) 250-2153 1150 Blue Mound Rd West Suite 301 Haslet, TX 76052 'DWH 4XRWH1R53/6 &RPSDQ\7H[DV6WHUOLQJ5HFRQVWUXFWLRQ (PDLOMLPP\UHHG#VWUOFRFRP $WWQ-LPP\5HHG 3KRQH 5H&RSSHOO7H[DV±)UHHSRUW5HFRQVWUXFWLRQ 5DQJHOLQHZLOOSHUIRUPWKHIROORZLQJ:HOGLQJ6HUYLFHV 0DWHULDO 4XDQWLW\ 'HVFULSWLRQ 8QLW ([WHQGHG 67$1'$5'352'8&7,21237,21 ´&3([´')ODQJH[´&3(7HH ´%XWW6WUDS´[´ZLGHZJURXWEDQG ´+DUGZD\%DU%DFNXS5LQJ :HOG6HUYLFHWR,QVWDOO7ZR´%XWW6WUDSV1RUPDO %XVLQHVV+RXUV 727$/ 586+352'8&7,21237,21 ´&3([´')ODQJH[´&3(7HH ´%XWW6WUDS´[´ZLGHZJURXWEDQG ´+DUGZD\%DU%DFNXS5LQJ :HOG6HUYLFHWR,QVWDOO7ZR´%XWW6WUDSV1RUPDO %XVLQHVV+RXUV 727$/ 6((%(/2:)256&+('8/('(7$,/6 7KLVTXRWDWLRQLVSURYLGHGZLWKRXWEHQHILWRISODQVDQGVSHFLILFDWLRQV7DNHRIIVDUHSURYLGHGDVDFRXUWHV\RQO\ DQGZHPDNHQRUHSUHVHQWDWLRQRUZDUUDQW\UHJDUGLQJWKHLUDFFXUDF\RUFRPSOHWHQHVV<RXWKHUHIRUHUHPDLQ UHVSRQVLEOHIRUYHULI\LQJRXUFDOFXODWLRQVSULRUWRPDQXIDFWXUHDQGVKLSPHQW$Q\FKDQJHVWRWKHOLVWHG PDWHULDOVPXVWEHQHJRWLDWHGDQGZLOOEHFKDUJHGEDVHGRQRXU6WDQGDUG3ULFLQJ )UHLJKW)2%2ULJLQ3UH3DLGDQG$GG 3ULFHVDUHEDVHGRQ x6WDQGDUG3URGXFWLRQ6FKHGXOHZHHNVIRUGUDZLQJVWRZHHNVIRUIDEULFDWLRQDIWHUDSSURYDO x5XVK3URGXFWLRQ6FKHGXOHZHHNIRUGUDZLQJVWRZHHNVIRUIDEULFDWLRQ x,IWKHW\SHRISLSHFKDQJHVIURPZKDWZHKDYHTXRWHGDERYHSULFHVDQGVFKHGXOLQJPD\YDU\&RQWUDFWRU RU0XQLFLSDOLW\LVUHVSRQVLEOHIRUYHULI\LQJWKHW\SHRISLSHDQGLW¶V2' x&RQFUHWH3UHVVXUH3LSHPDWHULDOVDUHFXVWRPPDGH2QFHPDWHULDORUGHULVSODFHGWKH\DUHQRQUHWXUQDEOH 6%(&HUWLILHG&RQWUDFWRU Rangeline Pipeline Services, LLC. Main Office (682) 250-2153 1150 Blue Mound Rd West Suite 301 Haslet, TX 76052 x5DQJHOLQHPD\UHTXLUHDSUHFRQVWUXFWLRQPHHWLQJSULRUWRVFKHGXOLQJDQ\VHUYLFHV x1RUPDOGD\WLPHKRXUV$0300RQGD\WKURXJK)ULGD\7HFKQLFLDQVZLOOKDYHD SHUKRXUDIWHUKRXUVFKDUJH$GGLWLRQDO([SHQVHVZLOOEHFKDUJHGDWRXUFRVWSOXV x5DQJHOLQHZLOODOORZ0RELOL]DWLRQV'H0RELOL]DWLRQVWRWKHMREVLWH$GGLWLRQDOWULSVZLOOEH SHUWULS x&DQFHOLQJDVFKHGXOHGSURMHFWDIWHUWKHWHFKQLFLDQVKDYHOHIWWKHVKRSZLOOUHVXOWLQD&DQFHOODWLRQ )HHSOHDVHUHIHUWR7HUPVDQG&RQGLWLRQV3DJH7KLVLQFOXGHVZHDWKHUUHODWHGFDQFHOODWLRQV x6WDQGE\FKDUJHVZLOOEHELOOHGDWSHUKRXUSHUWHFKQLFLDQGXULQJQRUPDOGD\WLPHKRXUV DQGSHUKRXUSHUWHFKQLFLDQGXULQJDIWHUKRXUV 7KLVLVDSDJHSURSRVDO3OHDVHUHDGLWLQLWVHQWLUHW\WKHQVLJQDQGUHWXUQSDJHSULRUWRVFKHGXOLQJZRUN Please see the attached page for the customer’s responsibility. $GGLWLRQDOFKDUJHVPD\EHDGGHGIRU,'EDGJHVVHFXULW\FKHFNLQRUMRESRVWSRQHPHQWVGXHWRVLWHHYHQWV $ERYHFRVWVGRQRWLQFOXGHRIILFHH[SHQVHIRUH[WHQVLYHFRQWUDFWDJUHHPHQWV 6XE&RQWUDFWDJUHHPHQWVZKHQUHTXLUHGPXVWEHUHFHLYHGE\5DQJHOLQH3LSHOLQH6HUYLFHV//&SULRUWRVWDUWLQJ ZRUN5DQJHOLQHZLOOQRWEHUHVSRQVLEOHIRUPHHWLQJDQ\UHTXLUHPHQWVVWDWHGLQD6XE&RQWUDFWDJUHHPHQWDIWHU WKHSURSRVHGZRUNKDVEHJXQ &HUWLILFDWHVRILQVXUDQFHZLWKFRQWUDFWRUDVDFHUWLILFDWHKROGHUFDQEHSURYLGHGDWQRFRVW$GGLQJFRQWUDFWRUDV DGGLWLRQDOLQVXUHGFDQQRWEHGRQHXQOHVVZHKDYHDZULWWHQFRQWUDFWZLWK\RXUFRPSDQ\&RYHUDJHUHTXLUHGDERYH WKHOLPLWVRIRXUSROLF\LVQRWLQFOXGHG 4XRWDWLRQLVYDOLGIRUGD\V 1RUHWDLQDJHDOORZHG ,I\RXKDYHDQ\TXHVWLRQVSOHDVHIHHOIUHHWRFRQWDFWRXUVDOHVWHDPLQ\RXUUHJLRQOLVWHGEHORZ Pipeline Services Manager Executive Admin Assistant Ryan Alumbaugh Samantha Wilson (214) 693-7684 ryan@rangeline.com (909) 991-4635 samantha@rangeline.com Technical Sales Representative Product Line Manager Cory Elling Ken Beul (817) 727-1097FRU\#UDQJHOLQHFRP (817) 247-7723 NHQ#UDQJHOLQHFRP 7KDQN\RXIRUWKHRSSRUWXQLW\WRTXRWH\RXUSURMHFW 6%(&HUWLILHG&RQWUDFWRU Rangeline Pipeline Services, LLC. Main Office (682) 250-2153 1150 Blue Mound Rd West Suite 301 Haslet, TX 76052 3OHDVHYLVLWRXU³1(:´ZHEVLWHDWZZZUDQJHOLQHFRP &86720(5,65(63216,%/()257+()2//2:,1* ;([FDYDWLQJGHZDWHULQJVKRULQJDQGRUVFDIIROGLQJRIMREDUHDDOORIZKLFKPXVW FRPSO\ZLWK26+$VWDQGDUGV ;¶H[WHQVLRQODGGHUOLJKWSROHDQGSXPSIRUGHZDWHULQJ ;6FKHGXOLQJLQVSHFWRUVDQGREWDLQLQJSHUPLWVDVQHFHVVDU\ ;/DERUDVVLVWDQFHRIBBPDQWREHVXSHUYLVHGE\5DQJHOLQH7HFKQLFLDQV ;3URYLGLQJPDWHULDOV ;,QVWDOOLQJDGGLWLRQDOPDWHULDOVVXSSOLHGE\RWKHU ;/LIWLQJHTXLSPHQWDQGDQDLUFRPSUHVVRUZLWKSHUVRQQHOWRRSHUDWH ;&RQFUHWHVXSSRUWIRUWKH7DSSLQJ9DOYHLIUHTXLUHG ;5HPRYDODQGFOHDQLQJRIDOOKD]DUGRXVDQGRUH[SORVLYHFKHPLFDOVIURPSLSHOLQH RQZKLFKZHOGLQJVHUYLFHLVWREHGRQH ;(OHFWULFSRZHUDQGOLJKWLQJDVUHTXLUHG ;&OHDQXSDQGGHEULVUHPRYDO ;-REVLWHVXSHUYLVRUVDQGRULQVSHFWLRQ ;/DERUWRDVVLVWLQGUDJJLQJZHOGLQJOHDGVKRUWSLSHDQGDLUKRVHLQDQGRXWRI SLSHOLQH ;/DERU PDWHULDOIRUJURXWLQJ 6%(&HUWLILHG&RQWUDFWRU Rangeline Pipeline Services, LLC. Main Office (682) 250-2153 1150 Blue Mound Rd West Suite 301 Haslet, TX 76052 ZĂŶŐĞůŝŶĞWŝƉĞůŝŶĞ^ĞƌǀŝĐĞƐ͕>>͘ͲdĞƌŵƐĂŶĚŽŶĚŝƚŝŽŶƐ 5DQJHOLQHKDVLVVXHGWKLVTXRWDWLRQEDVHGXSRQDOOLQIRUPDWLRQSURYLGHGE\WKH&XVWRPHU $OOSULFHVTXRWHGDUHVXEMHFWWRFXUUHQWVDOHVDQGXVHWD[HV$Q\LQFUHDVHRUHQDFWPHQWRIQHZVDOHVXVHH[FLVHRUVLPLODUWD[HVVKDOOEHIRUWKHDFFRXQWRI &XVWRPHU 7KHSULFHVTXRWHGDERYHDUHEDVHGXSRQWKHTXDQWLWLHVVL]HVDQGRSHUDWLQJFRQGLWLRQVDVOLVWHGDERYH$Q\FKDQJHVLQTXDQWLWLHVVL]HVRURSHUDWLQJFRQGLWLRQV RIWKHV\VWHPZLOOYRLGWKLVTXRWDWLRQDQGDQHZTXRWDWLRQZLOOEHLVVXHGRQWKHEDVLVRIFKDQJHGLQIRUPDWLRQRURSHUDWLQJFRQGLWLRQV$Q\SURMHFWVWKDWDUH ERRNHGDQGLQSURJUHVVWKDWUHTXLUHFKDQJHVLQWKHTXDQWLWLHVVL]HVDQGRURSHUDWLQJFRQGLWLRQVWKDWGLIIHUZLWKWKLVTXRWDWLRQZLOOEHVXEMHFWWRSULFLQJFKDQJHV EDVHGXSRQQHZGDWDUHODWHGWRWKHSURMHFW ,QWKHFDVHRIXQXVXDORUQRQW\SLFDOSLSHYDULDWLRQVWKHFXVWRPHUZLOOEHVXEMHFWWRDGGLWLRQDOFRVWV 7KHEDVHSULFHTXRWHGLVWKHPLQLPXPFKDUJHIRUWKHQXPEHURIGD\VDOORZHGDQGLVQRWVXEMHFWWRSURUDWLRQIRUZRUNFRPSOHWHGHDUO\7LPHRQVLWHIRU FDOFXODWLQJWKHEDVHSHULRGDQGWKHDGGLWLRQDOGD\VFRPPHQFHVWKHGD\WKHWHFKQLFLDQRUHTXLSPHQWDUHRQWKHMREVLWHDQGHQGVZKHQHTXLSPHQWOHDYHVWKH MREVLWHRUFXVWRPHU¶VFXVWRG\$Q\DGGLWLRQDOGD\VWKHHTXLSPHQWLVRQWKHMREVLWHZLOOEHSDLGE\&XVWRPHUDWWKHSHUGD\FKDUJHTXRWHG:KHQMREVLWHRU WUDYHOGD\VIDOORQZHHNHQGVRUKROLGD\VWKHSULFHTXRWHGZLOOEHLQFUHDVHGDFFRUGLQJWRWKHMREYDOXH 5DQJHOLQHVKDOOQRWEHKHOGOLDEOHIRUDQ\EDFNFKDUJHVZLWKRXWSULRUZULWWHQFRQVHQWRI5DQJHOLQH5DQJHOLQHGRHVQRWJXDUDQWHHWKDWWKHSODFHPHQWRIWKH /LQH6WRSKHDGVLQWRWKHSLSHV\VWHPWKHILUVWWLPHZLOOSURYLGHD³:RUNDEOH´VKXWGRZQ,QWKHHYHQWLWLVQHFHVVDU\IRU5DQJHOLQHWRUHPRYHWKH/LQH6WRS KHDGDQGUHSODFHDVHDODQGPDNHDQ\DGMXVWPHQWVWRWKHKHDGHTXLSPHQWVXFKDFWLYLW\VKDOOQRWEHFRQVLGHUHGDGHOD\RIZRUNDWWKHMREVLWH 5DQJHOLQHPDNHVHYHU\HIIRUWWRHQVXUH³26+$´VDIHZRUNLQJFRQGLWLRQVIRULWVHPSOR\HHV&XVWRPHUDJUHHVDQGVKDOOSURYLGH5DQJHOLQHHPSOR\HHVZLWK VDIHZRUNLQJFRQGLWLRQVSULRUWRHQWHULQJWKHZRUNSODFH 5DQJHOLQHFDQQRWWDNHUHVSRQVLELOLW\IRUDFWLRQVRWKHUWKDQLWVRZQHPSOR\HHV5DQJHOLQHZLOOEHOLDEOHDQGZLOOKROG&XVWRPHUKDUPOHVVIURPWKH FRPSHQVDWRU\EXWQRWFRQVHTXHQWLDOGDPDJHVFDXVHGVROHO\E\GHIHFWLQ5DQJHOLQH¶VHTXLSPHQWRUFDXVHGVROHO\E\WKHQHJOLJHQFHRI5DQJHOLQHHPSOR\HHV LQWKHRSHUDWLRQRIWKHHTXLSPHQW$OORWKHUORVVHVFRVWVH[SHQVHVOLDELOLW\RUGDPDJHVDULVLQJIURPRUFRQQHFWHGZLWKWKHSHUIRUPDQFHRIWKHZRUNZLOOQRW EHWKHUHVSRQVLELOLW\RI5DQJHOLQHDQGFXVWRPHUZLOOLQGHPQLI\DQGKROG5DQJHOLQHKDUPOHVVWKHUHIURP 5DQJHOLQHPDNHVQRZDUUDQW\RQDQ\SXUFKDVHGSURGXFWV3OHDVHUHIHUWRPDQXIDFWXUHUIRUGHWDLOVRQZDUUDQW\ 0DQXIDFWXUHUVRI9DOYH,QVHUWVGRQRWJXDUDQWHHDVKXWGRZQ5DQJHOLQHFDQQRWH[FHHGWKH0DQXIDFWXUHUV¶JXDUDQWHHRIYDOYHSHUIRUPDQFH:HLQVWDOO DOOYDOYHLQVHUWVDVSHUPDQXIDFWXUHUV¶VSHFLILHGSURFHGXUHV127(9DOYH,QVHUWVDUHQRWGHVLJQHGWREHSUHVVXUHWHVWHGDJDLQVW$UHVWRFNLQJIHHZLOO EHDVVHVVHGIRUDOOUHWXUQHG9DOYHV ,QWKHFDVHRIXQXVXDOOLQHVWRSSLQJFRQGLWLRQV5DQJHOLQHPD\UHTXLUHDQRZQHURIWKHSLSLQJV\VWHPRUWKHLUUHSUHVHQWDWLYHWREHSUHVHQWGXULQJWKHSUHVVXUH WHVWLQJRIPDWHULDOVDQGLQVHUWLRQRIWKH/LQH6WRSLQWRWKHLUV\VWHP 5DQJHOLQHZLOOSURYLGH7DSSLQJDQG/LQH6WRSSLQJHTXLSPHQWDQGDWHFKQLFLDQWRRSHUDWHHTXLSPHQW&XVWRPHULVUHVSRQVLEOHIRUSURYLGLQJDOORWKHU HTXLSPHQWVXSHUYLVLRQDQGODERUQHFHVVDU\WRFRPSOHWHWKHZRUNLQFOXGLQJLQVSHFWLRQWHVWLQJVDIHW\DQGFRQWUROHTXLSPHQWOLIWLQJDQGPRYLQJHTXLSPHQW HWF &XVWRPHUVKDOOSD\IRUDOOFRVWVDQGH[SHQVHVLQFXUUHGE\5DQJHOLQHEHFDXVHRIUHVFKHGXOLQJRUFDQFHOODWLRQE\WKHFXVWRPHUIRUDQ\UHDVRQLQFOXGLQJLQFOHPHQW ZHDWKHU ,QUHJDUGVWRFRQFUHWHSLSHRQO\WKHFRQGLWLRQRIWKHLQWHULRUPRUWDUOLQLQJPD\DGYHUVHO\DIIHFWWKHSHUFHQWDJHRIWKHDPRXQWUHFRYHUHGGXULQJWDSSLQJ RSHUDWLRQ5DQJHOLQHFDQQRWEHKHOGUHVSRQVLEOHIRUDQ\XQIRUHVHHQDQGRUGLPLQLVKHGFRQGLWLRQVRIVXFKSLSH $OOPDWHULDOVIDEULFDWHGIRU3&&3 5&3SLSHVDUHQRQUHWXUQDEOHRQFHIDEULFDWHG7KHFXVWRPHULVUHVSRQVLEOHIRUWKHDFFXPXODWHGFRVWVRIWKHPDWHULDOV IUHLJKWDQGVDOHVWD[IRUDOOWKHVHLWHPVRQFHRUGHUHG7KHVHPDWHULDOVDUHFXVWRPRUGHUHGDQG³1215(7851$%/(´ 7KHVXSSO\RIELGDQGRUSHUIRUPDQFHERQGVLVH[FOXGHG:HVXSSO\WKHVHERQGVRQO\ZKHQVSHFLILFDOO\VWDWHGRQWKHTXRWDWLRQ $Q\LQYRLFHXQSDLGIRUPRUHWKDQGD\VZLOOEHVXEMHFWWRWKHPD[LPXPILQDQFHFKDUJHVDOORZHGE\DSSOLFDEOHVWDWHODZ5DQJHOLQHGRHVQRWDOORZUHWDLQDJH RQDQ\LQYRLFHV &OHULFDOHUURUVDUHVXEMHFWWRFRUUHFWLRQ 1RWZLWKVWDQGLQJWKHVHWHUPVDQGFRQGLWLRQVRUDQ\DPHQGPHQWVWKHUHWRRUWHUPVDQGFRQGLWLRQVRIWKHFXVWRPHUZKRPD\EHGHHPHGSDUWRIWKLVDJUHHPHQW 5DQJHOLQHVKDOOQRWEHOLDEOHIRUDQ\ORVVHVFRVWVH[SHQVHVOLDELOLW\RUGDPDJHVDULVLQJIURPRUFRQQHFWHGZLWKWKHSHUIRUPDQFHRIWKHZRUNQRWFRYHUHGE\ 5DQJHOLQH¶VOLDELOLW\LQVXUDQFHLQHIIHFWDWWKHWLPHRIVXFKORVVHWFDQG&XVWRPHUVKDOOKROG5DQJHOLQHKDUPOHVVIRUDQ\ORVVHWFLQH[FHVVRIFRYHUDJH 5DQJHOLQHZLOOSURYLGH&XVWRPHUDFHUWLILFDWHRILWVOLDELOLW\LQVXUDQFHXSRQUHTXHVW ,QWKHHYHQWLWEHFRPHVQHFHVVDU\IRU5DQJHOLQHWRUHWDLQOHJDOFRXQVHOWRHQIRUFHLWVULJKWVWKHFXVWRPHUDJUHHVWKDWLWVKDOOEHUHVSRQVLEOHIRUSD\PHQWRIDOO UHDVRQDEOHDWWRUQH\¶VIHHVH[SHQVHVDQGFRVWVLQFXUUHG 5DQJHOLQHVKDOOQRWEHKHOGOLDEOHIRUDQ\SLSHZKLFKEUHDNVRUOHDNVDVDUHVXOWRIPDWHULDOLQVWDOODWLRQWDSSLQJSLSHOLQHVWRSSLQJSLSHRUFRPSOHWLRQRIOLQH VWRSILWWLQJ5DQJHOLQHIROORZVDOOPDWHULDOPDQXIDFWXUHUV¶LQVWDOODWLRQSURFHGXUHVDQGRSHUDWHVDOOHTXLSPHQWWRPDQXIDFWXUHU¶VVWDQGDUGVDQGFDQQRWEHKHOG UHVSRQVLEOHIRUSLSHZKLFKIDLOVGXULQJWKH7DSSLQJDQG/LQH6WRSSLQJRSHUDWLRQ 5DQJHOLQHZLOOWDNHDOOPHDQVDYDLODEOHWRFDSWXUHWKHSLSHFRXSRQ3LSHLQWHJULW\IORZUDWHVDQGRWKHUXQNQRZQVDWWKHWLPHRIWKH:HW+RW7DSSLQJRSHUDWLRQ FDQEHFRQWULEXWLQJIDFWRUV7KHUHIRUH5DQJHOLQHFDQQRWEHUHVSRQVLEOHIRUDQ\ORVWRUSLHFHVRIFRXSRQVZKLFKGRQRWFRPHRXWDIWHUWKHWDSLVSHUIRUPHG 5DQJHOLQHGRHVQRWJXDUDQWHHDOHDNIUHH&RPSOHWLRQ3OXJLQVWDOODWLRQ7KH&RPSOHWLRQ3OXJLVDWHPSRUDU\VHDOWRUHPRYH WKHLVRODWLRQYDOYHWRLQVWDOOWKHSHUPDQHQWEOLQGIODQJHDQGVHDOLQJKDUGZDUH ƵƐƚŽŵĞƌZĂŶŐĞůŝŶĞ ^ŝŐŶĂƚƵƌĞͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ^ŝŐŶĂƚƵƌĞͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺͺ ƵƐƚŽŵĞƌĂĐŬŶŽǁůĞĚŐĞƐĂŶĚĂĐĐĞƉƚƐĂůůŝŶĨŽƌŵĂƚŝŽŶƌĞŐĂƌĚŝŶŐƐƵƉƉůŝĞĚƋƵŽƚĂƚŝŽŶ͘ ! !"#$% !"& "# $#% # # "!'"'"! (( & # '%# )$$ * + &' !% "' " ,$-. "$.$, $ $. "$.$ , %'"! - ,$- + ' '"""$$*%"$' !%'"$-% "$ ,/$ 0*0 "$.$' ""/1$ 23 "$.$' " %".$'$ $'"!/45!$'" $-#",$.$6'"$"".0"4"$- '7'"!$-'$6"!$ '!" ". .%"$ ! # (#%# "")$$" 6% &" 8, '$ $&'9':", ".')$$ 3'$,23&" ;'. '".,0*0&" ;,235' . !,0*05'. !$', '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # (8('$ ".' -+, '$ "' " ,$-. "$.$, $ $. "$.$ , %'"!- ,$- + ' '"""$$*%"$' !%'"$-% "$ , /$ 0*0 "$.$' ""/1$ 23 "$.$' " %".$' $ $'"!/45!$'"$-#",$.$6'"$"".0"4"$- '7'"!$-'$ 6"!$ '!"". .%"$ )%% % % ! ! $%#&# / %# !# /,## .# 0 # 1# #& (#%)# !# # ! % 0% -, 1 MEMORANDUM To: Mayor and City Council From: Kent Collins P.E., Director of Public Works Date: November 13, 2018 Reference: Annual Sidewalk, Street & Alley Pavement Repair Contract 2030: Sustainable City Government, Goal 3 Excellent and Well-maintained City Infrastructure and Facilities General Information: x This is the second renewal of the contract approved in 2017. x The original contract was a 1-year renewable contract for up to 5 years, this is year 3 of that renewal. x The budget amount will be $1,500,000.00 ($1,000,000.00 Street Repairs plus $500,000.00 ADA) x The project will be renewed by the original two contractors. x The first contractor will service the area east of Denton Tap with 60% of the budget. x The second contractor will service the area west of Denton Tap with 40% of the budget. Introduction: This agenda item is being presented for approval of the renewal of the contract to two separate contractors with each performing a share of the ADA repairs and annual street & alley pavement repair program. Analysis: In order to provide well-maintained City infrastructure, our concrete sidewalks, streets and alleys require ongoing maintenance and repair. Preventative maintenance and repair work will extend the life of the concrete paving. To increase the level of proactive maintenance and decrease the repair “down” time for resident requested repairs, a bid package was assembled to encompass sidewalks, alleys and streets. This should allow the contractor to service all concrete issues in one location with a single mobilization, to reduce resident inconvenience and increase contractor efficiency. Additionally, to maintain full coverage of the City in all concrete scopes of work, two contracts will be renewed for the same bid package. The two contractors were selected through the competitive low bid process and awarded in January 2017. F&F Concrete was low bid and NPL Construction Company was second lowest bid. Two bids were awarded to ensure adequate resources to complete all repairs in a timely manner. Approximately $500,000.00 of the total project will be for ADA improvements identified 2 in the ADA Self Evaluation & Transition Plan presented to City Council on September 13, 2016. The attached list identifies streets and alleys that are expected to be addressed in some manner under these contracts. Upon approval of the renewal, the locations will be re-evaluated and prioritized based on field conditions. The contractors will then work on the list utilizing the available funding. Any locations not addressed will be re-evaluated next fiscal year. This year, there will not be a full alley replacement project, but we will focus on panel replacements and repairs. The repair and replacement locations are identified via the project list based on resident repair requests, as well as the Fugro data. F&F Concrete will be renewed for 60% of the project value to correspond to the area east of Denton Tap. NPL Construction will be renewed for 40% of the project value to correspond to the area west of Denton Tap. 2018ǦǦ2019 Street, Alley, Sidewalk & Ramps Total Funding Primary F&F (60%) Secondary NPL (40%) Street and Alley Repair $1,000,000 $600,000 $400,000 ADA Improvements $500,000 $300,000 $200,000 $1,500,000 $900,000 $600,000 Legal Review: The Purchasing Department has reviewed the documents and determined that this is an appropriate method of contracting with this firm. Fiscal Impact: The fiscal impact of this agenda item is $1,500,000.00 as budgeted in IMF. Recommendation: The Public Works Department recommends renewal of the contract with F&F Concrete for $900,000.00 and NPL Construction Company for $600,000.00. 2B3A2A1A4A4B1C1BSECONDCONTRACTOR- NPLConstructionFIRSTCONTRACTOR- F&FConcreteTexas Parks & Wildlife, Esri, HERE, DeLorme, INCREMENT P, Intermap, USGS, EPA, USDAFRepair Grid MapStreet, Alley, and SidewalkCity of CoppellCreated by Kevin R.January 3, 2017Testing - City Assett Repair GridCreated in ArcGIS Pro version 1.3SANDY LAKE RDSANDY LAKE RDDENTON TAP RDBELT LINE RDMOORE RDMACARTHUR BLVDSAMUEL BLVDSOUTHWESTERN BLVDSH 121SH 121BELT LINE RD Current Street and Alley Needs List - To Be Prioritized Annually Utilizing Fugro Study and Field Review Quadrant Section Type Street Address Range 1 A Alley Simmons Dr. 144-152 1 A Street/Alley Simmons Dr. 200 1 A Alley Simmons Dr. 204 to 216 1 A Street Simmons Dr. 152-156 1 A Alley Simmons Dr. 244 1 A Alley Castlebury Ct. 135 1 A Alley Highland Meadow Cir. 132-140 1 A Alley Highland Meadow Cir. 184 -192-200-212 1 A Street Cambria Dr. 446 1 A Alley Clear Creek Ln. 419 1 A Alley Clear Creek Ln. 402 to 490 1 A Street Clear Creek Ln. 430 1 A Alley Shadowcrest Ln. 542 1 A Alley Shadowcrest Ln. 554-562 1 A Alley Shadowcrest Ln. 566 1 A Alley Shadowcrest Ln. 574 1 A Alley Shadowcrest Ln. 572 1 A Alley Shadowcrest Ln. 582 1 A Street Park Meadow Way 324 1 A Street Park Meadow Way 320-324 1 A Street Park Meadow Way 305-309 1 A Street Woodway 441 1 A Street Woodhill Dr. 413 1 A Alley Greenridge Dr. 440 to 444 1 A Street Greenridge Dr. 521 1 A Street Rolling Hills Cir. 401 to 407 1 A Street Woodhurst Dr. 315 1 A Street Woodhurst Dr. 322 1 A Street Woodhurst Dr. 326 1 A Street Woodhurst @ Hillhaven 1 A Alley Edgewood Dr. 203 1 A Street E. Bethel Rd. 236 1 A Street Sandy Oak Ln. 123 1 A Street Lakewood Ct. 304 1 A Alley Lakewood Ct. 328 1 B Street S. Moore Rd. 101 1 B Street S. Moore Rd. 130 1 B Street S. Moore Rd. 157 1 B Alley Quail 672 1 B Street Quail 672 1 B Alley Pheasant Ln 605-609 1 B Alley Pheasant Ln 621 1 B Alley Pheasant Ln 625 1 B Alley Pheasant Ln 633-637 1 B Street Pheasant Ln 622 1 B Street Sparrow Ln. 713 1 B Street Sparrow Ln. 729 1 B Street Sparrow Ln. 736 to 744 1 B Alley Sparrow Ln. 725 1 B Alley Robin Ln. 725 to 733 1 B Alley Robin Ln. 737 to 749 1 B Alley Robin Ln. 700 1 B Alley Robin Ln. 720 1 B Street Robin Ln. 724 1 Current Street and Alley Needs List - To Be Prioritized Annually Utilizing Fugro Study and Field Review 1 B Alley Cardinal 732 1 B Alley Oriole 702 to 730 1 B Alley Mockingbird 160 1 B Alley Mockingbird Ln. 201 1 B Street Mockingbird 232 1 B Alley Havencrest 606 1 B Alley Villawood 700 1 B Street Villawood Ln. 712 1 B Street Villawood Ln. 728 1 B Alley Cherrybark 100 1 B Alley Hill 117 1 B Alley Hill 153 1 B Street Hill Rd. 161 1 B Alley Mesquitewood 103 1 B Alley Mesquitewood 127-131 1 B Alley Mesquitewood 147 1 B Alley Mesquitewood 102 1 B Alley Mesquitewood 128 1 B Alley Mesquitewood 136 1 B Alley Mesquitewood 202 1 B Alley Creekside Ln. 111 1 B Alley Creekside Ln. 119 1 B Alley Sugarberry Dr. 907 1 B Alley Bitternut Dr. 868 1 B Street Redcedar Way Dr. 805 1 B Street Redcedar Way Dr. 813 1 B Alley Timber Ridge 320 1 B Alley S. MacArthur Blvd 101 1 B Alley Pinyon 218 to 226 1 B Alley Pinyon 230 1 B Alley Pinyon 254-258 1 B Alley Pinyon 270-274 1 B Alley Pinyon 278 1 B Street Pinyon 270-278 1 B Alley Rolling Brook 915 1 B Alley Rolling Brook Ln. 916 1 B Street Rolling Brook 1002 1BAlley Pinyon/Pepperwood 302 thur 314 1BAlley Pinyon/Pepperwood 318 thur 330 1BAlley Pinyon/Pepperwood 338 1BAlley Pinyon/Pepperwood 346 1BAlley Pinyon/Pepperwood 350 1BAlley Redcedar Way 832 & 900 1BStreet Falcon Ln.801 to 841 1 B Alley Falcon Ln. 900 1 B Alley Falcon Ln. 908 to 920 1 B Alley Falcon Ln 932 to 944 1 B Alley Falcon Ln 952 1 B Alley Falcon Ln 956 to 960 1 B Alley Condor Dr. 976 to 980 1 B Alley Condor Dr. 988 1 B Alley Dunlin 309 1 B Alley Mallard Dr. 951 1 B Alley Mallard Dr. 971 1 B Alley Mallard Dr. 975 2 Current Street and Alley Needs List - To Be Prioritized Annually Utilizing Fugro Study and Field Review 1 B Alley Mallard Dr. 922-926 1 B Alley Mallard Dr. 846-902 1 B Alley Sora Ln. 504 1 B Street Sora 509 1 B Alley Redwing Dr. 981 1 B Alley Willet 410-418 1 B Alley Bethel School E. 907 1 B Alley Blue Jay Ln. 809 1 B Alley Blue Jay Ln. 837 1 B Alley Pelican 770 1 B Street Bethel School E 1021 1 B Street Bethel School E 603 1 B Street Bethel School E 628 1 B Street Bethel School E 632 1 B Street Bethel School E. 705-709 1 B Street Bethel School E. 713 1 B Street Bethel School E. 1 B Street Bethel School E 745 1 B Alley Bethel School E. 802 to 810 1 B Alley Bethel School E. 818 1 B Street Bethel School E. 815 1 B Street Bethel School E. 826 1 B Alley Bethel School E. 830 1 B Alley Bethel School E. 827 1 B Street Bethel School E. 846 1 B Alley Hollow Cir 684 1 B Alley Hidden Hollow Ct 964 1 B Alley Crestview Dr. 941 1 B Alley Crestview Dr. 949 1 B Alley Crestview Dr. 953 1 B Street Mockingbird/Crestview 1 B Street S. MacArthur Blvd 820 1 C Alley Longmeadow Dr. 209 1 C Alley Pebble Creek 1518 1 C Alley Pebble Creek 1522 1 C Alley Breanna Way 1312 1 C Alley Breanna Way 1324 1 C Alley Breanna Way 1305 1 C Alley Breanna Way 1309 to 1313 1 C Alley Bradford Dr. 1290 1 C Alley Bradford Dr. 1330 1 C Alley Bradford Dr. 1318 to 1322 1 C Alley Brittany Dr. 202 1 C Alley Wellington Rd. 612 1 C Alley Wellington Rd. 424 1 C Alley Wellington Rd. 500 1 C Alley Coral Dr. 1344 1 C Alley Barrington Dr. 1402 1 C Alley Barrington Dr. 1338 2 A Street Lyndsie 277 2 A Street Lyndsie 317 2 A Street Waterview Dr. 513 2 A Alley Claremont Ct. 610 2 A Alley Bella Vista Dr. 718 to 734 2 A Street Glen Lakes Dr. 634 3 Current Street and Alley Needs List - To Be Prioritized Annually Utilizing Fugro Study and Field Review 2 A Alley Glen Lakes Dr. 663 2 A Alley Cribbs Dr. 662 2 A Alley Cribbs Dr. 614 2 A Alley Cribbs Dr. 622 2 A Alley Cribbs Dr. 634 2 A Alley Cribbs Dr. 642 2 A Street Phillips 617 2 A Street Phillips 648 2 A Alley Phillips 313 2 A Alley Harrison 600 2 A Street Parr St. 642 2AStreet Park Valley/Heartz 2A Street Park Valley 184 2 A Alley Chestnut/Kailey Way 2 A Alley Kailey Way 264-268 2 A Drain Flum Parkview Pl. 324 2 A Street Parkview Pl. 432 2 A Street Clear Haven 309 2 A Alley Crooked Tree Ct 329 2 A Alley Park Valley 128-132 2 A Alley Park Valley 132 2 A Alley Park Valley 180 2 A Alley Dickens Dr. 109 2 A Alley Dickens Dr. 133 to 137 2 A Alley Pecan Hollow 323 2 A Alley Plumlee Pl 626-630 2 A Alley Reeder 259 2 A Alley Reeder 263 2 A Alley Stringfellow 522 2 A Alley Trailwood Ln. 141 2 A Alley Trailwood 105 2 A Street Tanglewood Ln. 322 2 A Alley Tanglewood Ln. 334 2 B Street W. Peninsula Dr. 673 2 B Street W. Peninsula Dr. 653 2 B Street Inglenook Ct 629 2 B Street Deforest Ct. 673 2 B Alley Deforest Ct. 673 2 B Street Parker Dr. 949 2 B Alley Raintree Cir 532 2 B Street Raintree Cir 568 2 B Alley Village Green 567 2 B Alley Ashford Dr. 805 2 B Alley Lakeview Dr. 823 2 B Alley Allen Rd. 627 2 B Street Brown Trl 925 2 B Street Beverly Dr. 530 to 534 2 B Alley Beverly Dr. 527 2 B Alley Gibbs Crossing 1030 2 B Street Basilwood Dr. 1004 2 B Street Forestwood Ln. 1014 2 B Alley Forestwood Ln. 1019 2 B Alley Cherrywood 1005 2BStreet Greenway 751 2 B Alley Parkway 739-743 4 Current Street and Alley Needs List - To Be Prioritized Annually Utilizing Fugro Study and Field Review 2 B Alley Parkway 801 2 B Street Parkway Blvd. 636 2 B Alley Cove Dr. 344 2 B Alley Mariners Ct. 884 to 892 2 B Alley Mariners Ct. 883 2 B Alley Misty Harbor Ct 890 2 B Street Meadow Run Cir 2 B Street Meadow Run Cir 2 B Alley MeadowGlen Cir. 109 2 B Alley Cascade Way 116 3 A Alley Banker Cottage Ln. 735 3 A Alley Copperstone Trl 311 3 A Street Copperstone Trl 314 3 A Alley Gifford 411 3 A Street Pedmore 521 3 A Alley Westchester Dr. 1339 3 A Street Canyon Dr. 601-750-751 3 A Alley Leisure Ln. 444 3 A Alley Summer Place Dr. 125 3 A Street Summer Place Dr. 112 4 A Street Hearthwood Dr. 136 4 A Street Branchwood Trl. 116 4 A Street Branchwood Trl. 128,129,132,133 4 A Street Branchwood Trl. 140,141,144,145 4 A Street Oakbend Dr. 134 4 A Street Oakbend Dr. 663 4 A Street Post Oak Dr. 701 4 A Street Manchester Ln. 111 4 A Street Forest Ridge Dr. 457 4 A Alley Halifax Ln. 529 4 A Street Halifax Ln. 512 to 516 4 A Alley Halifax Ln. 508 4 A Alley Newport 185 4 A Street Fieldcrest Loop 112 4 A Street Fieldcrest Loop 116 4 A Street Fieldcrest Loop 120 4 A Street Fieldcrest Loop 132 4 A Street Fieldcrest Loop 136 4 A Street Fieldcrest Loop 206 4 A Alley Whispering Hills 257 4 A Street Magnolia 224 4 A Street Magnolia 241 4 A Street Magnolia 257-265 4 A Alley Ashley 315 4 A Alley Ashley 323 4 A Alley Ashley 331-343 4 A Alley Delta Ct. 227 to 231 4 A Street Spanish Moss cul-de-sac to Steamboat 4 A Street Jeb Ct. 201 4 A Alley Plantation 217 4 A Alley Plantation 221 4 A Alley Plantation 225-241 4 A Street Carriage Ct 205 4 A Alley W. Bethel School Rd. 208 4 A Street W. Bethel School Rd. 204 to 208 5 Current Street and Alley Needs List - To Be Prioritized Annually Utilizing Fugro Study and Field Review 4 A Street W. Bethel School Rd. 4 A Alley W. Bethel School Rd. 212 4 A Street Harris St. 449 4 A Street Lynn Ct. 540 4 A Street Brooks 313 4 A Street Brooks 317 4 A Street Brooks 321 4 A Street Brooks 407 4 A Street Brooks 420 4 A Street Anderson Ave. 521 4 A Street Anderson Ave. @ Cozby Ave. 4 A Street Cooper Ln. 407 to 409 4 A Street Cooper Ln. 410 4 A Street Cooper Ln. 416 & 417 4 A Street Cozby Ave. 410 4 A Alley Archer 554-579 4 A Alley Hawken 524 4 A Street Armstrong St. 706 4 A Street Kaye St. 404 4 A Alley S. Coppell Rd. 804 to 806 4 A Street Northpoint (median West of Royal) 4 A Street Northpoint Dr. 201 4 A Street Royal Ln (NB at Post Office entrance) 4 A Street Royal/Northpoint (Northbound Royal) 4 A Street Royal (south of Northlake College) 4 A Street Royal 601 4 A Street Royal 621 4 A Street Royal 2nd. Request on 8/13/2013 675 4 A Street Gateview Blvd. 4 A Street Royal/Creekview 4 B Street Dividend (east side of Freeport Pkwy) 4 B Street Crestside Dr. 1333 4 B Street Lakeshore Dr. 1225 6 !"#$% !"& !" #"$ " " '( )) % " &$" * &+ "$+$( ",(+ "( -" !%"$.$ "$/($ - 01 "2" " "$+$( ",(+0 "$+$( "*"!2- $/+ "$+$( " - '(,$$( "3"& +"$("+("!+ "$+$( ",(+- 4"$/ (5("!$/($*"!$ (!"""+ +%"$ " '"$" * &,$--*% -* & -" "$+$( "6" "($( "-,$"' % - !%"$- &$(" '"$" )"* "$ '$+ ) ,*+ &$" # #" " &$"* -% ! " )7)($ "+( ,*+ ($ "( -" !%"$.$ "$/($ - 01 "2"" "$+$( ",(+0 "$+$( "*"!2- $/+ "$+$( " -'(,$$( "3" & +"$("+("!+ "$+$( ",(+- 4"$/ (5("!$/($ *"!$ (!"""+ +%"$ MEMORANDUM To:Mayor and City Council From: Date: Reference: Kevin Richardson - Fire Chief November 13, 2018 Consider approval of an Agreement between the City of Coppell (Owner) and Byrne Construction Services (Construction Manager) for the construction of Fire Station #4 and Resource Center including Preconstruction Services for $25,000 and authorizing the City Manager to sign any necessary documents. General Information: •The request for proposals for Construction Management Services were advertised October 19th and 26th, 2018. •Eight firms submitted proposals: Byrne, CORE, EMJ, Key Construction, MDI, Sedalco, Speed Fab-Crete and Steele-Freeman. •Evaluations and grading were conducted on Nov. 5th and 6th, 2018. •Byrne Construction Services is recommended as Construction Manager at Risk for Fire Station #4 and Resource Center. •The same selection process and Agreement was most recently used for The Coppell Arts Center. •The Contract will be amended by a later Council Action Item to reflect the Guaranteed Maximum Price once it is finalized in Spring of 2019. Introduction In October, a Request for Proposals was advertised for the eventual selection of a Construction Manager for Fire Station #4 and Resource Center. Evaluations were held in November 5th and 6th with eight firms competing for the assignment. Based on the evaluation Byrne Construction Services was recommended by staff for eventual approval by the City Council. The terms for the contract include Preconstruction Services, Construction Phase, and the Not-To-Exceed General Conditions Costs, based on an estimated construction cost of $7.4 million. This Action Item, the master Agreement with Byrne Construction Services is the next step in the process for them to serve as the Construction Manager for Fire Station #4 and Resource Center. Once a Guaranteed Maximum Price is secured, the Council will then consider an amendment to this agreement to authorize the construction of Fire Station #4 and Resource Center. Analysis: The agreement puts into place the General Conditions for Byrne Construction Services to engage in the Fire Station #4 and Resource Center construction project. Included in this master agreement is the pricing for Byrne to provide cost analysis and value engineering throughout the design process. General Conditions are also included within the contract, which will be implemented when the Guaranteed Maximum Price (GMP) for the construction portion of the project is established. The GMP will be and presented to Council as an Amendment to this contract at a later date. Legal Review: The attached agreement was reviewed by Coppell’s Legal Counsel. Fiscal Impact: The services included for the agreement with Byrne Construction Services including preconstruction services for Fire Station #4 and Resource Center total $25,000. Recommendation: The Fire Department recommends approval of the agreement with Byrne Construction Services (Construction Manager) including Preconstruction Services in the amount of $25,000. RFP #162 CMAR FIRE STATION #4 AND RESOURCE CENTER CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page |37 PROPOSAL Construction Manager-at-Risk for City of Coppell Construction Manager at Risk for Fire Station #4 and Resource Center RFP #162 Submitted by: _______________________________________________________ Having examined the Request for Proposal, the undersigned proposes to furnish Construction Management-At-Risk services as required for this project as follows: Pre-Construction Phase Fee, Construction Phase Fee and General Conditions shall be based on the following project construction budget of approximately: $7,600,000.00 Pre-Construction Phase Fee, Construction Phase Fee and General Conditions shall be based on the following project schedule: Preconstruction ____6___ months Construction __12___ months 1. Pre-Construction Phase Fee: To included personnel expense, project estimates, preliminary project schedules, value engineering, constructability reviews, pre-planning, overhead and profit, and other services through the pre-construction phase of the Project. Pre-Construction Phase Fee: $___________ . 2. Construction Phase Fee: Identify a Construction Phase Fee Percentage and dollars of the construction budget for all home office expenses and any other expenses not included in the Allowable General Conditions Costs identified in Exhibit ‘A’, including all overhead and profit. Construction Phase Fee Percentage: %___________ . Construction Phase Fee Dollars: $____________. 3. Not-To-Exceed General Conditions Costs: General Conditions Percentage: %___________ . Thos. S. Byrne Inc. dba Byrne Construction Services 25,000 3.25% 247,000 8.6% ATTACHMENT A RFP #162 CMAR FIRE STATION #4 AND RESOURCE CENTER CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page |38 General Conditions Dollars: $ ____________ . Monthly General Conditions Dollars: $_____________. Using the not-to-exceed General Conditions identified above, list all project management, bonds, insurance, field office and office supplies costs for the Project(s). Allowable General Conditions Line Items (see list below): On Site Management Staff subtotal $______ Bonds and Insurance subtotal $______ Temporary Project Utilities subtotal $______ Field Office & Office Supplies subtotal $______ Total $______ Estimated On-Site Project Management Staff and Rates: Position Quantity Months Monthly Salary Rate Project Executive _______ ______ _________________ Project Manager _______ ______ _________________ Superintendent(s) _______ ______ _________________ Asst. Superintendents _______ ______ _________________ Project Engineer(s) _______ ______ _________________ Fields/Office Engineers(s) _______ ______ _________________ Field Support Staff _______ ______ _________________ Scheduler _______ ______ _________________ Safety Manager _______ ______ _________________ 6 5 132,789 7 76,838 6 1 (20% Onsite) 12 $3,0 1 (100% Onsite) 12 $11, 1 (100% Onsite) 12 $11, 1 (20% Onsite) 12 $1,006 1 (20% Onsite) 12 $1,775 RFP #162 CMAR FIRE STATION #4 AND RESOURCE CENTER CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page |39 4. Addenda: Acknowledgement of Addenda to this RFP (if applicable). No. 1 ___ No. 2 ____ No. 3 _____ No. 4 _____ No. 5 ______ Respectfully Submitted and Certified By: ____________________________________ _____________________ (Printed Name) (Title) ____________________________________ _____________________ (Authorized Signature) (Date) N/A N/A N/A N/A N/A Paul Avila Chief Operating Officer __________________________________________________________________________ rintedeededededdededdeddedededdedddeddededdeddeddddeddededdededededeedeeeeeeeeeeeeeeeeeeeeeeeeeeeeee Name))))))))))))))))) _________________________________________________________________ Paul Avilaalaaalaaaaalaaaaalalaalaaaaaaaaaalaaaaaaaaaalaalaalaaaaaaaaaaallaalllllll Z&WηϭϲϮDZ&/Z^dd/KEηϰEZ^KhZEdZ *HQHUDO&RQGLWLRQV 'HVFULSWLRQ 4XDQWLW\8QLW &RVW8QLW,QFOXGLQJ $OO%XUGHQ,QVXUDQFH (WF 7RWDO 2Q6LWH3URMHFW0DQDJHPHQW 3URMHFW([HFXWLYH2QVLWH 0R 3URMHFW0DQDJHU2QVLWH 0R 6XSHULQWHQGHQWV2QVLWH 0R $VVLVWDQW6XSHULQWHQGHQWV 0R 2IILFH(QJLQHHUV 0R 3URMHFW([SHGLWRU 0R 6FKHGXOHU 0R 3URMHFW6XSSRUW6WDII2QVLWH 0R &RVW(QJLQHHU 0R 6DIHW\&RRUGLQDWRU2QVLWH 0R 7HPSRUDU\3URMHFW&RQVWUXFWLRQDQG 8WLOLWLHVIRU&06WDII 'XPSVWHUVIRU&06WDII 0R 0RQWKO\7HOHSKRQH6HUYLFH 0R 3URMHFW:DWHU7HPS:DWHUDQG0HWHUV 0R 3URMHFW(OHFWULF7HPS3RZHU 0R )HQFLQJDQG&RYHUHG:DONZD\V /6 7HPSRUDU\7RLOHWV 0R 7HPSRUDU\)LUH3URWHFWLRQ 0R 7HOHSKRQH6\VWHP,QVWDOODWLRQ,QWHUQHW /6 &HUHPRQLHV /6 &2: (OHFWULFDODQGVWDUWXSSRZHU /6 )LHOG2IILFHVDQG2IILFH6XSSOLHVIR &06WDII 3DUWQHULQJ&RVWV /6 &2: -RE3KRWRVDQG9LGHRV 0R &03URMHFW6SHFLILF6LJQDJH /6 3RVWDJHDQG'HOLYHULHV 0R 6HFXULW\6\WHP:DWFKPDQ 0R &2: 3URMHFW$V%XLOWV /6 0RELOL]DWLRQIRU2IILFH7UDLOHUV 0RYH,Q2XW /6 0RQWKO\2IILFH5HQWDO&RVWV 0R 6WRUDJH7UDLOHUV 0R )LHOG2IILFH(TXLSPHQW 0R 9HKLFOHVLQFOXGLQJ)XHO0DLQWHQDQFHDQ ,QVXUDQFH 0R 6DIHW\(TXLSPHQW 0R )LUVW$LG6XSSOLHV /6 -RE2IILFH6XSSOLHV 0R -DQLWRULDO6HUYLFHV 0R &2: 3URMHFW&RPSXWHUVDQG6RIWZDUH 0R )LHOG2IILFH)XUQLWXUH /6 &RS\0DFKLQHDQG6XSSOLHV 0R 3URSRVDO)RUP (;+,%,7 $ &RQVWUXFWLRQ0DQDJHUDW5LVNIRU&RQVWUXFWLRQRI)LUH6WDWLRQDQG5HVRXUFH&HQWHU /dzK&KWW>>ͻWhZ,^/E'WZdDEdͻϮϱϱWZ<tzKh>sZͻKWW>>͕dy^ϳϱϬϭϵ RFP #162 CMAR FIRE STATION #4 AND RESOURCE CENTER CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page |37 PROPOSAL Construction Manager-at-Risk for City of Coppell Construction Manager at Risk for Fire Station #4 and Resource Center RFP #162 Submitted by: _______________________________________________________ Having examined the Request for Proposal, the undersigned proposes to furnish Construction Management-At-Risk services as required for this project as follows: Pre-Construction Phase Fee, Construction Phase Fee and General Conditions shall be based on the following project construction budget of approximately: $7,600,000.00 Pre-Construction Phase Fee, Construction Phase Fee and General Conditions shall be based on the following project schedule: Preconstruction ____6___ months Construction __12___ months 1. Pre-Construction Phase Fee: To included personnel expense, project estimates, preliminary project schedules, value engineering, constructability reviews, pre-planning, overhead and profit, and other services through the pre-construction phase of the Project. Pre-Construction Phase Fee: $___________ . 2. Construction Phase Fee: Identify a Construction Phase Fee Percentage and dollars of the construction budget for all home office expenses and any other expenses not included in the Allowable General Conditions Costs identified in Exhibit ‘A’, including all overhead and profit. Construction Phase Fee Percentage: %___________ . Construction Phase Fee Dollars: $____________. 3. Not-To-Exceed General Conditions Costs: General Conditions Percentage: %___________ . Thos. S. Byrne Inc. dba Byrne Construction Services 25,000 3.25% 247,000 8.6% ATTACHMENT A RFP #162 CMAR FIRE STATION #4 AND RESOURCE CENTER CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page |38 General Conditions Dollars: $ ____________ . Monthly General Conditions Dollars: $_____________. Using the not-to-exceed General Conditions identified above, list all project management, bonds, insurance, field office and office supplies costs for the Project(s). Allowable General Conditions Line Items (see list below): On Site Management Staff subtotal $______ Bonds and Insurance subtotal $______ Temporary Project Utilities subtotal $______ Field Office & Office Supplies subtotal $______ Total $______ Estimated On-Site Project Management Staff and Rates: Position Quantity Months Monthly Salary Rate Project Executive _______ ______ _________________ Project Manager _______ ______ _________________ Superintendent(s) _______ ______ _________________ Asst. Superintendents _______ ______ _________________ Project Engineer(s) _______ ______ _________________ Fields/Office Engineers(s) _______ ______ _________________ Field Support Staff _______ ______ _________________ Scheduler _______ ______ _________________ Safety Manager _______ ______ _________________ 6 5 132,789 7 76,838 6 1 (20% Onsite) 12 $3,0 1 (100% Onsite) 12 $11, 1 (100% Onsite) 12 $11, 1 (20% Onsite) 12 $1,006 1 (20% Onsite) 12 $1,775 RFP #162 CMAR FIRE STATION #4 AND RESOURCE CENTER CITY OF COPPELL • PURCHASING DEPARTMENT • 255 PARKWAY BOULEVARD • COPPELL, TEXAS 75019 Page |39 4. Addenda: Acknowledgement of Addenda to this RFP (if applicable). No. 1 ___ No. 2 ____ No. 3 _____ No. 4 _____ No. 5 ______ Respectfully Submitted and Certified By: ____________________________________ _____________________ (Printed Name) (Title) ____________________________________ _____________________ (Authorized Signature) (Date) N/A N/A N/A N/A N/A Paul Avila Chief Operating Officer __________________________________________________________________________ rintedeededededdededdeddedededdedddeddededdeddeddddeddededdededededeedeeeeeeeeeeeeeeeeeeeeeeeeeeeeee Name))))))))))))))))) _________________________________________________________________ Paul Avilaalaaalaaaaalaaaaalalaalaaaaaaaaaalaaaaaaaaaalaalaalaaaaaaaaaaallaalllllll ! !"#$%& !"#' "# $#% # # () ** & # '%# ()+%%) #,()- -. #) % -.()- /0)#%12 ,3)- 4 -)%5%. ".#$#% -!"&#% )%.6 % #7% #! #-)/67!1)##& #%# %% -89#%. ):)#"%. 2 % )"# ! # (#%# +%;;2& ;()- 0)#% 333;67!0 %; <%) ' %; '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # *3*)% #-) -+, )% #) % -.()- /0)#%12 ,3)-4 -)%5 %. ".#$#% -!"&#% )%.6 % #7% #! #-)/67!1)##& #% # %% -89#%. ):)#"%.2 % )"# +&& %;;&& % % .;)-)&-% ;%.)"#)%&)8# % ;%. #$ ! $%#&# .()<%&#%- &&# ! / %# !# /,## MEMORANDUM To: From: Date: Reference: 2030: Mayor and City Council Kevin Richardson, Fire Chief November 13, 2018 Consider approval to purchase Fire Truck (Quint) Model #300205-751 Pierce Velocity 107` through an Interlocal Agreement with Houston Galveston Area Council (H-GAC) not to exceed $1,200,000 and authorizing the City Manager to sign. Sustainable City Government Introduction: The Coppell Fire Department is in the process of moving forward with the implementing the addition of Fire Station #4. The plan is for the department to add a Pierce Velocity 107’ Aerial Ascendant Quint to the fleet to be the frontline response apparatus for the new fire station. The new apparatus would serve many functions including requirements to support our Cass 1 ISO rating from the Insurance Service Office. Analysis: On August 29, 2017, City Council chose to move forward with implementing the addition of Fire Station #4, relocation of Fire Station #1, and relocation of the Resource Storage Facility. A multi-year plan was developed, and City Council has already approved to move forward with Architectural Design, Land Acquisition and Program Manager Services. Funding for the unit was planned and budgeted in the Capital Improvement Plan (CIP) and included in the Certificate of Obligation (CO) issuance for General Government projects. Legal Review: Agenda item did not require legal review. Fiscal Impact: The fiscal impact of this agenda item is $1,200,000. Recommendation: The Fire Department recommends approval. Proposal 303954.3 1/2 11-05-2018 3500 Shelby Lane Denton, Texas 76207 GDN P115891 TXDOT MVD No. A115890 EIN 27-4333590 November 5, 2018 Mark Daniels, Deputy Chief Coppell Fire Department 265 Parkway Blvd Coppell TX 75019 Proposal for 2019 Ascendant 107 Quint Siddons-Martin Emergency Group, LLC is pleased to provide the following proposal to Coppell Fire Department. Unit will comply with all specifications attached and made a part of this proposal. Total price includes delivery FOB Coppell Fire Department and training on operation and use of the apparatus. Description Amount 300205, No. 751, Velocity 107` Quint Pierce, Velocity, Aerial, HD Ladder - 107, ISX 12 500, 500 gal, Hale 2000 Price guaranteed for 27 days. Delivery within 9.5-10.5 months of order date. A warranty term of 12 months is included. Vehicle Price $ 1,145,903.00 Chassis Prepay Discount ( $ 11,885.00). $ 395,176.00 due with order. Prepay Discount ($ 11,885.00) Aerial Prepay Discount ( $ 5,208.00). $ 260,399.00 due with order. Prepay Discount ($ 5,208.00) Full Prepay Discount ( $ 19,333.00). Total amount due with order. To receive full prepayment discounts, payment is due to Siddons-Martin within 30 days ARO. Prepay Discount ($ 19,333.00) SUB TOTAL $ 1,109,477.00 H-GAC FS12-17 $ 2,000.00 TOTAL $ 1,111,477.00 Taxes. Tax is not included in this proposal. In the event that the purchasing organization is not exempt from sales tax or any other applicable taxes and/or the proposed apparatus does not qualify for exempt status, it is the duty of the purchasing organization to pay any and all taxes due. Balance of sale price is due upon acceptance of the apparatus at the factory. Late Fee. A late fee of .033% of the sale price will be charged per day for overdue payments beginning ten (10) days after the payment is due for the first 30 days. The late fee increases to .044% per day until the payment is received. In the event a prepayment is received after the due date, the discount will be reduced by the same percentages above increasing the cost of the apparatus. Cancellation. In the event this proposal is accepted and a purchase order is issued then cancelled or terminated by Customer before completion, Siddons-Martin Emergency Group may charge a cancellation fee. The following charge schedule based on costs incurred may be applied: (A) 10% of the Purchase Price after order is accepted and entered by Manufacturer; (B) 20% of the Purchase Price after completion of the approval drawings; (C) 30% of the Purchase Price upon any material requisition. The cancellation fee will increase accordingly as costs are incurred as the order progresses through engineering and into manufacturing. Siddons-Martin Emergency Group endeavors to mitigate any such costs through the sale of such product to another purchaser; however, the customer shall remain liable for the difference between the purchase price and, if applicable, the sale price obtained by Siddons-Martin Emergency Group upon sale of the product to another purchaser, plus any costs incurred by Siddons-Martin to conduct such sale. Proposal 303954.3 2/2 11-05-2018 Acceptance. In an effort to ensure the above stated terms and conditions are understood and adhered to, Siddons-Martin Emergency Group, LLC requires an authorized individual from the purchasing organization sign and date this proposal and include it with any purchase order. Upon signing of this proposal, the terms and conditions stated herein will be considered binding and accepted by the Customer. The terms and acceptance of this proposal will be governed by the laws of the state of TX. No additional terms or conditions will be binding upon Siddons-Martin Emergency Group, LLC unless agreed to in writing and signed by a duly authorized officer of Siddons-Martin Emergency Group, LLC. Sincerely, Travis Ownby Siddons-Martin Emergency Group, LLC I, ________________________________________, the authorized representative of Coppell Fire Department, agree to purchase the proposed and agree to the terms of this proposal and the specifications attached hereto. __________________________________________ Signature & Date y Travis Ownby Contract No.:FS12-17 Date Prepared:11/05/18 Buying Agency:Contractor: Contact Person: Prepared By: Phone:Phone: Fax:Fax: Email:Email: Product Code:TA03 Description: $841,352.00 Cost Cost $263,518.00 Subtotal B: $263,518.00 Cost Cost $60,983.07 Subtotal C: $60,983.07 5.52% 1 1165853.069 = Subtotal D: $1,165,853.07 Subtotal E: $2,000.00 Cost Cost -$11,885.00 -$5,208.00 -$19,333.00 -$19,950.07 Subtotal F: -$56,376.07 $1,111,477.00 Description Description C. Unpublished Options - Itemize below / attach additional sheet(s) if necessary. (Note: Unpublished options are items which were not submitted and priced in Contractor's bid.) Subtotal From Additional Sheet(s): B. Published Options - Itemize below - Attach additional sheet(s) if necessary - Include Option Code in description if applicable. (Note: Published Options are options which were submitted and priced in Contractor's bid.) jdoran@siddons-martin.com E. H-GAC Order Processing Charge (Amount Per Current Policy) D. Total Cost Before Any Applicable Trade-In / Other Allowances / Discounts (A+B+C) F. Trade-Ins / Other Allowances / Special Discounts / Freight / Installation X Subtotal of A + B + C: DescriptionDescription CONTRACT PRICING WORKSHEET For MOTOR VEHICLES Only Pierce Custom Chassis, 4-Door Full Tilt Aluminum Cab, Formed Aluminum Body, Single Axle, 107' Rear-Mounted Telescoping Ladder A. Product Item Base Unit Price Per Contractor's H-GAC Contract: 281-442-0850 This Worksheet is prepared by Contractor and given to End User. If a PO is issued, both documents MUST be faxed to H-GAC @ 713-993-4548. Therefore please type or print legibly. Coppell Fire Department (751) Brad Smith 9727543248 esmith@coppelltx.gov Siddons-Martin Emergency Group Jeff Doran 800-784-6806 G. Total Purchase Price (D+E+F): Delivery Date: Sept/1/2019 Subtotal From Additional Sheet(s): Quantity Ordered: For this transaction the percentage is: Check: Total cost of Unpublished Options (C) cannot exceed 25% of the total of the Base Unit Price plus Published Options (A+B). Description Description Trade-in Allowance Aerial Pre-Payment DiscountChassis Pre-Payment Discount 100% Pre-Payment Discount Proposal Details Report OptionCode Type Option ProposalText 0010012 No Boiler Plates requested 0018180 Single Source Compliance, Aerials SINGLE SOURCE MANUFACTURER Pierce Manufacturing, Inc. provides an integrated approach to the design and manufacture of our products that delivers superior apparatus and a dedicated support team. From our facilities, the chassis, cab weldment, cab, pump house (including the sheet metal enclosure, valve controls, piping and operators panel) body and aerial device will be entirely designed, tested, and hand assembled to the customer's exact specifications. The electrical system either hardwired or multiplexed, will be both designed and integrated by Pierce Manufacturing. The warranties relative to these major components (excluding component warranties such as engine, transmission, axles, pump, etc.) will be provided by Pierce as a single source manufacturer. Pierce's single source solution adds value by providing a fully engineered product that offers durability, reliability, maintainability, performance, and a high level of quality. 0584456 Manufacture Location, Appleton, Wisconsin Your apparatus will be manufactured in Appleton, Wisconsin. 0584452 RFP Location: Appleton, Wisconsin 0588609 Vehicle Destination, US 0610784 Comply NFPA 1901 Changes Effective Jan 1, 2016, With Exceptions NFPA 2016 STANDARDS This unit will comply with the NFPA standards effective January 1, 2016, except for fire department directed exceptions. These exceptions will be set forth in the Statement of Exceptions. Certification of slip resistance of all stepping, standing and walking surfaces will be supplied with delivery of the apparatus. All horizontal surfaces designated as a standing or walking surface that are greater than 48.00" above the ground must be defined by a 1.00" wide line along its outside perimeter. Perimeter markings and designated access paths to destination points will be identified on the customer approval print and are shown as approximate. Actual location(s) will be determined based on materials used and actual conditions at final build. Access paths may pass through hose storage areas and opening or removal of covers or restraints may be required. Access paths may require the operation of devices and equipment such as the aerial device or ladder rack. A plate that is highly visible to the driver while seated will be provided. This plate will show the overall height, length, and gross vehicle weight rating. The manufacturer will have programs in place for training, proficiency testing and performance for any staff involved with certifications. An official of the company will designate, in writing, who is qualified to witness and certify test results. 0533351 Quint Fire Apparatus 0588612 Vehicle Certification, Aerial w/Pump 11/3/2018 Customer:Coppell Fire Department Bid Number: 751 Representative Ownby, Travis Job Number: Requirements Manager: Organization:Siddons-Martin Emergency Group Description:Velocity single axle quint Chassis:Velocity Chassis, Aerials, Single Axle, Ascendant (Big Block) Body:Aerial, HD Ladder 107' ASL Single, Quint, Alum Body 1751Bid #: 0681278 Agency, Apparatus Certification, Aerial w/Pump, U.L. NFPA COMPLIANCY Apparatus proposed by the bidder will meet the applicable requirements of the National Fire Protection Association (NFPA) as stated in current edition at time of contract execution. Fire department's specifications that differ from NFPA specifications will be indicated in the proposal as "non-NFPA". VEHICLE INSPECTION PROGRAM CERTIFICATION To assure the vehicle is built to current NFPA standards, the apparatus, in its entirety, will be third-party, audit-certified through Underwriters Laboratory (UL) that it is built and complies to all applicable standards in the current edition of NFPA 1901. The certification will include: all design, production, operational, and performance testing of not only the apparatus, but those components that are installed on the apparatus. A placard will be affixed in the driver's side area stating the third party agency, the date, the standard and the certificate number of the whole vehicle audit. INSPECTION CERTIFICATE A third party inspection certificate for the aerial device will be furnished upon delivery of the aerial device. The certificate will be Underwriters Laboratories Inc. Type 1 and will indicate that the aerial device has been inspected on the production line and after final assembly. Visual structural inspections will be performed on all welds on both aluminum and steel ladders. On critical weld areas, or on any suspected defective area, the following tests will be conducted: - Magnetic particle inspection will be conducted on steel aerials to assure the integrity of the weldments and to detect any flaws or weaknesses. Magnets will be placed on each side of the weld while iron powder is placed on the weld itself. The powder will detect any crack that may exist. This test will conform to ASTM E709 and be performed prior to assembly of the aerial device. - A liquid penetrant test will be conducted on aluminum aerials to assure the integrity of the weldments and to detect any flaws or weaknesses. This test will conform to ASTM E165 and be performed prior to assembly of the aerial device. - Ultrasonic inspection will conducted on all aerials to detect any flaws in pins, bolts and other critical mounting components. In addition to the tests above, functional tests, load tests, and stability tests will be performed on all aerials. These tests will determine any unusual deflection, noise, vibration, or instability characteristics of the unit. PUMP TEST The pump will be tested, approved and certified by Underwriter's Laboratory at the manufacturer's expense. The test results and the pump manufacturer's certification of hydrostatic test; the engine manufacturer's certified brake horsepower curve; and the manufacturer's record of pump construction details will be forwarded to the Fire Department. GENERATOR TEST If the unit has a generator, the generator will be tested, approved, and certified by Underwriters Laboratories at the manufacturer's expense. The test results will be provided to the Fire Department at the time of delivery. BREATHING AIR TEST If the unit has breathing air, Pierce Manufacturing will draw an air sample from the air system and certify that the air quality meets the requirements of NFPA 1989,Standard on Breathing Air Quality for Fire and Emergency Services Respiratory Protection. 2751Bid #: 0536644 Customer Service Website AFTERMARKET SUPPORT WEBSITE Pierceparts.com will provide Pierce authorized dealer access to comprehensive information pertaining to the maintenance and service of their customer's apparatus. This tool will provide the Pierce authorized dealer the ability to service and support their customers to the best of their ability with factory support at their fingertips. Pierceparts.com is also accessible to the end user through the guest login. Limited access is available and vehicle specific parts information accessible by entering a specific VIN number. All end users should see their local authorized Pierce dealer for additional support and service. The website will consist of the following screens at the dealer level: My Fleet Screen The My Fleet screen will provide access to truck detail information on the major components of the vehicle, warranty information, available vehicle photographs, vehicle drawings, sales options, applicable vehicle software downloads, etc. Parts Screens The Parts screens will provide parts look-up capability of Pierce Manufacturing sourced items, with the aid of digital photographs, part drawings and assembly drawings. The parts search application will permit the searching of parts by item description or function group (major system category). The parts application will provide the ability to submit electronically a parts order, parts quote, or parts return request directly to Pierce Manufacturing for processing. Warranty Screen The Warranty screens will provide dealers the ability to submit electronically warranty claims directly to Pierce Manufacturing for reimbursement. My Reports Screens The My Reports screens will provide access to multiple dealer reports to allow the dealership to maintain communication with the customer on the status of orders, claims, and phone contacts. Technical Support Screens The Technical Support screens will provide access to all currently published Operation and Maintenance and Service Publications. Access to Pierce Manufacturing Service Bulletins and Work Instructions, containing information on current service topics and recommendations will be provided. Training The Training screens will provide access to upcoming training classes offered by Pierce Manufacturing along with interactive electronic learning modules (Operators Guides) covering the operation of major vehicle components will be provided. Access to training manuals used in Pierce Manufacturing training classes will be provided. About Pierce Access to customer service articles, corporate news, quarterly newsletters, and key contacts within the Customer Service Department will be provided. The current Customer Service Policy and Procedure Manual, detailing the operation of the Customer Service group will also be accessible. 0537375 Unit of Measure, US Gallons 0529326 Bid Bond, 10%, Pierce Built Chassis BID BOND A bid bond as security for the bid in the form of a 10% bid bond will be provided with the proposal. This bid bond will be issued by a Surety Company who is listed on the U.S. Treasury Departments list of acceptable sureties as published in Department Circular 570. The bid bond will be issued by an authorized representative of the Surety Company and will be accompanied by a certified power of attorney dated on or before the date of bid. The bid bond will include language which assures that the bidder/principal will give a bond or bonds, as may be specified in the bidding or contract documents, with good and sufficient surety for the faithful performance of the contract, including the Basic One (1) Year Limited Warranty, and for the prompt payment of labor and material furnished in the prosecution of the contract. Notwithstanding any document or assertion to the contrary, any surety bond related to the sale of a vehicle will apply only to the Basic One (1) Year Limited Warranty for such vehicle. Any surety bond related to the sale of a vehicle will not apply to any other warranties that are included within this bid (OEM or otherwise) or to the warranties (if any) of any third party of any part, component, attachment or accessory that is incorporated into or attached to the vehicle. In the event of any contradiction or inconsistency between this provision and any other document or assertion, this provision will prevail. 0582697 Performance Bond, 100 Percent w/Warranty Bond, 1 Yr, and Payment Bond PERFORMANCE BOND, 1 YEAR The successful bidder will furnish a Performance and Payment bond (Bond) equal to 100 percent of the total contract amount within 30 days of the notice of award. Such Bond will be in a form acceptable to the Owner and issued by a surety company included within the Department of Treasury's Listing of Approved Sureties (Department Circular 570) with a minimum A.M. Best Financial Strength Rating of A and Size Category of XV. In the event of a bond issued by a surety of a lesser Size Category, a minimum Financial Strength rating of A+ is required. Bidder and Bidder's surety agree that the Bond issued hereunder, whether expressly stated or not, also includes the surety's guarantee of the vehicle manufacturer's Basic One (1) Year Limited Warranty period included within this proposal. Owner agrees that the penal amount of this bond will be simultaneously amended to 100 percent of the total contract amount upon satisfactory acceptance and delivery of the vehicle(s) included herein. Notwithstanding anything contained within this contract to the contrary, the surety's liability for any warranties of any type will not exceed one (1) year from the date of such satisfactory acceptance and delivery, or the actual Basic One (1) Year Limited Warranty period, whichever is shorter. 3751Bid #: 0000007 Approval Drawing APPROVAL DRAWING A drawing of the proposed apparatus will be prepared and provided to the purchaser for approval before construction begins. The Pierce sales representative will also be provided with a copy of the same drawing. The finalized and approved drawing will become part of the contract documents. This drawing will indicate the chassis make and model, location of the lights, siren, horns, compartments, major components, etc. A "revised" approval drawing of the apparatus will be prepared and submitted by Pierce to the purchaser showing any changes made to the approval drawing. 0002928 Electrical Diagrams ELECTRICAL WIRING DIAGRAMS Two (2) electrical wiring diagrams, prepared for the model of chassis and body, will be provided. 0614994 Velocity Chassis, Aerials, Single Axle, Ascendant (Big Block) VELOCITY CHASSIS The Pierce Velocity® is the custom chassis developed exclusively for the fire service. Chassis provided will be a new, tilt-type custom fire apparatus. The chassis will be manufactured in the apparatus body builder's facility eliminating any split responsibility. The chassis will be designed and manufactured for heavy-duty service, with adequate strength and capacity for the intended load to be sustained and the type of service required. The chassis will be the manufacturer's first line tilt cab. 0000110 Wheelbase WHEELBASE The wheelbase of the vehicle will be 233.50. 0000070 GVW Rating GVW RATING The gross vehicle weight rating will be 57,500. 0000203 Frame Rails, 13.38 x 3.50 x .375, Qtm/AXT/Imp/Vel/DCF FRAME The chassis frame will be built with two (2) steel channels bolted to five (5) cross members or more, depending on other options of the apparatus. The side rails will have a 13.38" tall web over the front and mid sections of the chassis, with a continuous smooth taper to 10.75" over the rear axle. Each rail will have a section modulus of 25.992 cubic inches and a resisting bending moment (rbm) of 3,119,040 in-lb over the critical regions of the frame assembly, with a section modulus of 18.96 cubic inches with an rbm of 2,275,200 in-lb over the rear axle. The frame rails will be constructed of 120,000 psi yield strength heat-treated 0.38" thick steel with 3.50" wide flanges. 0604483 Frame Liner, Inv "L" 12.68" x 3.00" x .25", AXT/Vel/Imp, 107' ASL, 56" Qval FRAME REINFORCEMENT In addition, a mainframe inverted "L" liner will be provided. It will be heat-treated steel measuring 12.00" x 3.00" x 0.25". Each liner will have a section modulus of 7.795 cubic inches, yield strength of 110,000 psi, and rbm of 857,462 in-lb. Total rbm at wheelbase center will be 3,976,502 in-lb. The frame liner will be mounted inside of the chassis frame rail. 0508846 Axle, Front, Oshkosh TAK-4, Non Drive, 24,000 lb, Velocity FRONT NON DRIVE AXLE The Oshkosh TAK-4® front axle will be of the independent suspension design with a ground rating of 24,000 lb. Upper and lower control arms will be used on each side of the axle. Upper control arm castings will be made of 100,000-psi yield strength 8630 steel and the lower control arm casting will be made of 55,000-psi yield ductile iron. The center cross members and side plates will be constructed out of 80,000-psi yield strength steel. Each control arm will be mounted to the center section using elastomer bushings. These rubber bushings will rotate on low friction plain bearings and be lubricated for life. Each bushing will also have a flange end to absorb longitudinal impact loads, reducing noise and vibrations. There will be nine (9) grease fittings supplied, one (1) on each control arm pivot and one (1) on the steering gear extension. The upper control arm will be shorter than the lower arm so that wheel end geometry provides positive camber when deflected below rated load and negative camber above rated load. Camber at load will be 0 degrees for optimum tire life. The ball joint bearing will be of low friction design and be maintenance free. Toe links that are adjustable for alignment of the wheel to the center of the chassis will be provided. The wheel ends must have little to no bump steer when the chassis encounters a hole or obstacle. The steering linkage will provide proper steering angles for the inside and outside wheel, based on the vehicle wheelbase. The axle will have a third party certified turning angle of 40 degrees. Front discharge, front suction, or aluminum wheels will not infringe on this cramp angle. 4751Bid #: 0090914 Suspension, Front TAK-4, 24,000 lb, DLX/Qtm/AXT/Vel/Enf FRONT SUSPENSION Front Oshkosh TAK-4™ independent suspension will be provided with a minimum ground rating of 24,000 lb. The independent suspension system has been designed to provide maximum ride comfort. The design will allow the vehicle to travel at highway speeds over improved road surfaces and at moderate speeds over rough terrain with minimal transfer of road shock and vibration to the vehicle's crew compartment. Each wheel will have a torsion bar type spring. In addition, each front wheel end will also have energy absorbing jounce bumpers to prevent bottoming of the suspension. The suspension design will be such that there is at least 10.00" of total wheel travel and a minimum of 3.75" before suspension bottoms. The torsion bar anchor lock system allows for simple lean adjustments, without the use of shims. One can adjust for a lean within 15 minutes per side. Anchor adjustment design is such that it allows for ride height adjustment on each side. The independent suspension was put through a durability test that simulated 140,000 miles of inner city driving. 0087572 Shock Absorbers, KONI, TAK-4, Qtm/AXT/Imp/Vel/DCF/Enf FRONT SHOCK ABSORBERS KONI heavy-duty telescoping shock absorbers will be provided on the front suspension. 0000322 Oil Seals, Front Axle FRONT OIL SEALS Oil seals with viewing window will be provided on the front axle. 0582746 Tires, Front, Goodyear, G296 MSA, 445/65R22.50, 20 ply FRONT TIRES Front tires will be Goodyear radials 445/65R22.50, 20 ply all-position G296 MSA tread, rated for 24,600 lb maximum axle load and 68 mph maximum speed. 0019618 Wheels, Front, Alcoa, 22.50" x 13.00", Aluminum, Hub Pilot The tires will be mounted on Alcoa 22.50" x 13.00" polished aluminum disc type wheels with a ten (10)stud, 11.25" bolt circle. 0598516 Axle, Rear, Meritor RS30-185, 33,500 lb, Imp/Vel/DCF REAR AXLE The rear axle will be a Meritor™, Model RS-30-185, with a capacity of 33,500 lb. 0544253 Top Speed of Vehicle, 68 MPH TOP SPEED OF VEHICLE A rear axle ratio will be furnished to allow the vehicle to reach a top speed of 68 mph. 0122073 Suspen, Rear, Standens, Spring, 33,500 lb, Imp/Vel/Dash CF/Enf REAR SUSPENSION The rear suspension will be Standens, semi-elliptical, 3.00" wide x 53.00" long, with a ground rating of 33,500 lb. The spring hangers will be castings. The two (2) top leaves will wrap the forward spring hanger pin, and the rear of the spring will be a slipper style end that will ride in a rear slipper hanger. To reduce bending stress due to acceleration and braking, the front eye will be a berlin eye that will place the front spring pin in the horizontal plane within the main leaf. A steel encased rubber bushing will be used in the spring eye. The steel encased rubber bushing will be maintenance free and require no lubrication. 0000485 Oil Seals, Rear Axle REAR OIL SEALS Oil seals will be provided on the rear axle(s). 0585004 Tires, Rear, Goodyear, G289 WHA, 315/80R22.50, 20 ply, Single REAR TIRES Rear tires will be four (4) Goodyear 315/80R22.50 radials with 20 ply G289 WHA tread, rated for 36,360 lb maximum axle load and 68 mph maximum speed. 0019675 Wheels, Rear, Alcoa, 22.50" x 9.00", Aluminum-Steel, Hub Pilot, Single The outside tires will be mounted on Alcoa© 22.50" x 9.00" polished aluminum disc wheels with a ten (10)stud 11.25" bolt circle. The inside tires will be mounted on 22.50" x 9.00" steel disc wheels with a ten (10) stud 11.25" bolt circle. 0568081 Tire Balancing, Counteract Beads TIRE BALANCE All tires will be balanced with Counteract balancing beads. The beads will be inserted into the tire and eliminate the need for wheel weights. 5751Bid #: 0620570 Tire Pressure Monitoring, RealWheels, AirSecure, Valve Cap, Single Axle TIRE PRESSURE MANAGEMENT There will be a RealWheels LED AirSecure™ tire alert pressure management system provided, that will monitor each tire's pressure. A sensor will be provided on the valve stem of each tire for a total of six (6) tires. The sensor will calibrate to the tire pressure when installed on the valve stem for pressures between 10 and 200 psi. The sensor will activate an integral battery operated LED when the pressure of that tire drops 5 to 8 psi. Removing the cap from the sensor will indicate the functionality of the sensor and battery. If the sensor and battery are in working condition, the LED will immediately start to flash. 0003245 Axle Hub Covers w/center hole, S/S, Front Axle FRONT HUB COVERS Stainless steel hub covers will be provided on the front axle. An oil level viewing window will be provided. 0003240 Axle Hub Covers, Rear, S/S Baby Moon (Pair) HUB COVERS (rear) Stainless steel baby moon covers will be provided over the rear axle hubs. 0057936 Covers, Lug Nut, Chrome CHROME LUG NUT COVERS Chrome lug nut covers will be supplied on front and rear wheels. 0002045 Mud Flaps, w/logo front & rear MUD FLAPS Mud flaps with a Pierce logo will be installed behind the front and rear wheels. 0544802 Chocks, Wheel, SAC-44-E, Folding WHEEL CHOCKS There will be one (1) pair of folding Ziamatic, Model SAC-44-E, aluminum alloy, Quick-Choc wheel blocks, with easy-grip handle provided. 0544806 Mounting Brackets, Chocks, SAC-44- E, Folding, Horizontal WHEEL CHOCK BRACKETS There will be one (1) pair of Zico, Model SQCH-44-H, horizontal mounting wheel chock brackets provided for the Ziamatic, Model SAC-44-E, folding wheel chocks. The brackets will be made of aluminum and consist of a quick release spring loaded rod to hold the wheel chocks in place. The brackets will be mounted below the left side rear compartment. 0010670 ABS Wabco Brake System, Single rear axle ANTI-LOCK BRAKE SYSTEM The vehicle will be equipped with a Meritor WABCO 4S4M, anti-lock braking system. The ABS will provide a 4-channel anti-lock braking control on both the front and rear wheels. A digitally controlled system that utilizes microprocessor technology will control the anti-lock braking system. Each wheel will be monitored by the system. When any particular wheel begins to lockup, a signal will be sent to the control unit. This control unit then will reduce the braking of that wheel for a fraction of a second and then reapply the brake. This anti-lock brake system will eliminate the lockup of any wheel thus helping to prevent the apparatus from skidding out of control. 0030185 Brakes, Knorr/Bendix 17", Disc, Front, TAK-4 BRAKES The service brake system will be full air type. The front brakes will be Knorr/Bendix disc type with a 17.00" ventilated rotor for improved stopping distance. The brake system will be certified, third party inspected, for improved stopping distance. 0000740 Brakes, Meritor, Cam, Rear, 16.50 x 8.63" The rear brakes will be Meritor™ 16.50" x 8.63" cam operated with automatic slack adjusters. Dust shields cannot be provided. 0020784 Air Compressor, Brake, Cummins/Wabco 18.7 CFM BRAKE SYSTEM AIR COMPRESSOR The air compressor will be a Cummins/WABCO with 18.7 cubic feet per minute output. 6751Bid #: 0000786 Brake Reservoirs, Four BRAKE SYSTEM The brake system will include: Bendix® dual brake treadle valve Heated automatic moisture ejector on air dryer Total air system capacity of 5,198 cubic inches Two (2) air pressure gauges with a red warning light and an audible alarm, that activates when air pressure falls below 60 psi Spring set parking brake system Parking brake operated by a push-pull style control valve A parking "brake on" indicator light on instrument panel Park brake relay/inversion and anti-compounding valve, in conjunction with a double check valve system, with an automatic spring brake application at 40 psi A pressure protection valve to prevent all air operated accessories from drawing air from the air system when the system pressure drops below 80 psi (550 kPa) 1/4 turn drain valve on each air tank The air tank will be primed and painted to meet a minimum 750 hour salt spray test. To reduce the effects of corrosion, the air tank will be mounted with stainless steel brackets. 0568012 Air Dryer, Wabco System Saver 1200, Heater, 2010 BRAKE SYSTEM AIR DRYER The air dryer will be WABCO System Saver 1200 with spin-on coalescing filter cartridge and 100 watt heater. 0000790 Brake Lines, Nylon BRAKE LINES Color-coded nylon brake lines will be provided. The lines will be wrapped in a heat protective loom in the chassis areas that are subject to excessive heat. 0000854 Air Inlet, w/Disconnect Coupling AIR INLET One (1) air inlet with 3D series male coupling will be provided. It will allow station air to be supplied to the apparatus brake system through a shoreline hose. The inlet will be located forward in the driver side lower step well of cab. A check valve will be provided to prevent reverse flow of air. The inlet will discharge into the "wet" tank of the brake system. A mating female fitting will also be provided with the loose equipment. 0690889 All Wheel Lockup (Aerial/Tanker Chassis), Aerial Master Activation ALL WHEEL LOCK-UP An additional all wheel lock-up system will be installed which applies air to the front brakes only. The standard spring brake control valve system will be used for the rear. The all wheel lock-up system will be activated automatically when the aerial master switch is activated. 0615609 Fittings, Compression Type, Entire Apparatus, Single Rear Axle COMPRESSION FITTINGS ONLY Any nylon tube on the apparatus that is pneumatic will be plumbed with compression type fittings where applicable. 0764546 Engine, Cummins X12, 500 hp, 1695 lb-ft, W/OBD, EPA 2018, Velocity ENGINE The chassis shall be powered by an electronically controlled engine as described below: Make: Cummins Model: X12 Power: 500 hp at 1900 rpm Torque: 1695 lb-ft at 1000 rpm Governed Speed: 2000 rpm Emissions Level: EPA 2018 Fuel: Diesel Cylinders: Six (6) Displacement: 720 cubic inches (11.8L) Starter: Delco 39MT™ Fuel Filters: Spin-on style primary filter with water separator and water-in-fuel sensor. Secondary spin-on style filter. The engine shall include On-board diagnostics (OBD), which provides self diagnostic and reporting. The system shall give the owner or repair technician access to state of health information for various vehicle sub systems. The system shall monitor vehicle systems, engine and after treatment. The system shall illuminate a malfunction indicator light on the dash console if a problem is detected. 7751Bid #: 0001244 High Idle w/Electronic Engine, Custom HIGH IDLE A high idle switch will be provided, inside the cab, on the instrument panel, that will automatically maintain a preset engine rpm. A switch will be installed, at the cab instrument panel, for activation/deactivation. The high idle will be operational only when the parking brake is on and the truck transmission is in neutral. A green indicator light will be provided, adjacent to the switch. The light will illuminate when the above conditions are met. The light will be labeled "OK to Engage High Idle." 0687994 Engine Brake, Jacobs Compression Brake, Cummins Engine ENGINE BRAKE A Jacobs® engine brake is to be installed with the controls located on the instrument panel within easy reach of the driver. The driver will be able to turn the engine brake system on/off and have a high, medium and low setting. The engine brake will activate when the system is on and the throttle is released. The high setting of the brake application will activate and work simultaneously with the variable geometry turbo (VGT) provided on the engine. The engine brake will be installed in such a manner that when the engine brake is slowing the vehicle the brake lights are activated. The ABS system will automatically disengage the auxiliary braking device, when required. 0552334 Clutch, Fan, Air Actuated, Horton Drive Master CLUTCH FAN A Horton® fan clutch will be provided. The fan clutch will be automatic when the pump transmission is in "Road" position, and fully engaged in "Pump" position. 0123135 Air Intake, w/Ember separator, Imp/Vel ENGINE AIR INTAKE An air intake with an ember separator (to prevent road dirt, burning embers, and recirculating hot air from entering the engine) will be mounted at the front of the apparatus, on the passenger side of the engine. The ember separator will be mounted in the air intake with flame retardant, roto- molded polyethylene housing. It will be easily accessible by the hinged access panel at the front of the vehicle. 0794743 Exhaust System, 5", X12/X15 Engine, Horizontal, Right Side EXHAUST SYSTEM The exhaust system will include a Single Module™ aftertreatment device to meet current EPA standards. The exhaust system will be stainless steel from the turbo to the inlet of the aftertreatment device, and will be 5.00" in diameter. An insulation wrap will be provided on all exhaust pipes between the turbo and aftertreatment device to minimize the heat loss to the aftertreatment device. The exhaust will terminate horizontally ahead of the right side rear wheels. A tailpipe diffuser will be provided to reduce the temperature of the exhaust as it exits. Heat deflector shields will be provided to isolate chassis and body components from the heat of the tailpipe diffuser. 0787999 Radiator, Impel/Velocity RADIATOR The radiator and the complete cooling system will meet or exceed NFPA and engine manufacturer cooling system standards. For maximum corrosion resistance and cooling performance, the entire radiator core will be constructed using long life aluminum alloy. The core will be made of aluminum fins, having a serpentine design, brazed to aluminum tubes. The tubes will be brazed to aluminum headers. The radiator core will have a minimum frontal area of 1434 square inches. Supply tank made of glass-reinforced nylon and a return tank of cast aluminum alloy shall be crimped on to the core assembly using header tabs and a compression gasket to complete the radiator core assembly. The radiator will be compatible with commercial antifreeze solutions. There will be a full steel frame around the entire radiator core assembly. The radiator core assembly will be isolated within the steel frame by rubber inserts to enhance cooling system durability and reliability. The radiator will be mounted in such a manner as to prevent the development of leaks caused by twisting or straining when the apparatus operates over uneven ground. The radiator assembly will be isolated from the chassis frame rails with rubber isolators. The radiator assembly will include an integral deaeration tank permanently mounted to the top of the radiator framework, with a readily accessible remote-mounted overflow tank. For visual coolant level inspection, the radiator will have a built-in sight glass. The radiator will be equipped with a 15 psi pressure relief cap. A drain port will be located at the lowest point of the cooling system and/or the bottom of the radiator to permit complete flushing of the coolant from the system. A heavy-duty fan will draw in fresh, cool air through the radiator. Shields or baffles will be provided to prevent recirculation of hot air to the inlet side of the radiator. 0616439 Cooling Hoses, Gates Silicone COOLANT LINES Gates® silicone hoses will be used for all engine/heater coolant lines installed by the chassis manufacturer. The chassis manufacturer will also use Gates brand hose on other heater, defroster and auxiliary coolant circuits. There will be some areas in which an appropriate Gates product is not available. In those instances, a comparable silicone hose from another manufacturer will be used. Hose clamps will be stainless steel "constant torque type" to prevent coolant leakage. They will react to temperature changes in the cooling system and expand or contract accordingly while maintaining a constant clamping pressure on the hose. 8751Bid #: 0001125 Fuel Tank, 65 Gallon, Left Side Fill FUEL TANK A 65 gallon fuel tank will be provided and mounted at the rear of the chassis. The tank will be constructed of 12-gauge, hot rolled steel. It will be equipped with swash partitions and a vent. To eliminate the effects of corrosion, the fuel tank will be mounted with stainless steel straps. A 0.75" drain plug will be located in a low point of the tank for drainage. A fill inlet will be located on the left hand side of the body and is covered with a hinged, spring loaded, stainless steel door that is marked "Ultra Low Sulfur - Diesel Fuel Only." A 0.50" diameter vent will be installed from tank top to just below fuel fill inlet. The fuel tank will meet all FHWA 393.67 requirements including a fill capacity of 95 percent of tank volume. 0001129 Lines, Fuel All fuel lines will be provided as recommended by the engine manufacturer. 0644984 DEF Tank, 4.5 Gallon, DS Fill, Rearward of Rear Axle, Double Dr DIESEL EXHAUST FLUID TANK A 4.5 gallon diesel exhaust fluid (DEF) tank will be provided and mounted in the driver's side body rearward of the rear axle. A 0.50" drain plug will be provided in a low point of the tank for drainage. A fill inlet will be located on the driver's side of the body and be covered with a hinged stainless steel door that is marked "Diesel Exhaust Fluid Only". The door will cover both the diesel fuel inlet as well as the DEF fill inlet. The hinged door will flip between the two, preventing accidental filling of the incorrect fluid. The tank will meet the engine manufacturers requirement for 10 percent expansion space in the event of tank freezing. The tank will include an integrated heater unit that utilizes engine coolant to thaw the DEF in the event of freezing. 0552793 Not Required, Fuel Priming Pump 0582243 Shutoff Valves, Fuel Line @ Primary Filter, Cummins FUEL SHUTOFF A fuel line shutoff valve will be installed on both the inlet and outlet of the primary fuel filter. 0553019 Cooler, Engine Fuel, Imp/Vel, AXT/Qtm/Sab/DCF/SFR/Enf FUEL COOLER An air to fuel cooler will be installed in the engine fuel return line. 0578959 Fuel/Water Separator, Racor Inline FUEL SEPARATOR The engine will be equipped with a Racor in-line spin-on fuel and water separator in addition to the engine fuel filters. 0642533 Trans, Allison 5th Gen, 4500 EVS P, w/Prognostics, Imp/Vel/DCF/Enf TRANSMISSION An Allison 5th generation, Model EVS 4500P, electronic, torque converting, automatic transmission will be provided. The transmission will be equipped with prognostics to monitor oil life, filter life, and transmission health. A wrench icon on the shift selector's digital display will indicate when service is due. Two (2) PTO openings will be located on left side and top of converter housing (positions 8 o'clock and 1 o'clock). A transmission temperature gauge with red light and buzzer will be installed on the cab instrument panel. 0512762 Transmission, Shifter, 6-Spd, Push Button, 4500, Imp/Vel/Qtm/DCF/Enf TRANSMISSION SHIFTER A six (6)-speed push button shift module will be mounted to right of driver on console. Shift position indicator will be indirectly lit for after dark operation. The transmission ratio will be: 1st - 4.70 to 1.00, 2nd - 2.21 to 1.00, 3rd - 1.53 to 1.00, 4th - 1.00 to 1.00, 5th - 0.76 to 1.00, 6th - 0.67 to 1.00, R - 5.55 to 1.00. 0684459 Transmission Oil Cooler, Modine, External TRANSMISSION COOLER A Modine plate and fin transmission oil cooler will be provided using engine coolant to control the transmission oil temperature. 0535530 Mode, Downshift, Aggressive downshift to 2nd, w/engine brake, 6 speed DOWNSHIFT MODE (w/engine brake) The transmission will be provided with an aggressive downshift mode. This will provide earlier transmission downshifts to 2nd gear from 6th gear, resulting in improved engine braking performance. 0001375 Driveline, Spicer 1810 DRIVELINE Drivelines will be a heavy-duty metal tube and be equipped with Spicer® 1810 universal joints. The shafts will be dynamically balanced before installation. A splined slip joint will be provided in each driveshaft where the driveline design requires it. The slip joint will be coated with Glidecoat® or equivalent. 9751Bid #: 0669988 Steering, Sheppard M110 w/Tilt, TAK-4, Eaton Pump, w/Cooler STEERING Dual Sheppard, Model M110, steering gears, with integral heavy-duty power steering, will be provided. For reduced system temperatures, the power steering will incorporate an air to oil cooler and an Eaton, Model VN20, hydraulic pump with integral pressure and flow control. All power steering lines will have wire braded lines with crimped fittings. A tilt and telescopic steering column will be provided to improve fit for a broader range of driver configurations. 0001544 Not Required, Steering Assist Cylinder on Front Axle 0509230 Steering Wheel, 4 Spoke without Controls STEERING WHEEL The steering wheel will be 18.00" in diameter, have tilting and telescoping capabilities, and a 4- spoke design. 0690274 Logo/Emblem, on Dash LOGO AND CUSTOMER DESIGNATION ON DASH The dash panel will have an emblem containing the Pierce logo and customer name. The emblem will have three (3) rows of text for the customer's department name. There will be a maximum of eight (8) characters in the first row, 11 characters in the second row and 11 characters in the third row. The first row of text will be: Coppell The second row of text will be: Fire The third row of text will be: Department 0524744 Bumper, 22" Extended, Steel, Painted, Imp/Vel BUMPER A one (1) piece bumper manufactured from 0.25" formed steel with a 0.38" bend radius will be provided. The bumper will be a minimum of 10.00" high with a 1.50" top and bottom flange, and will extend 22.00" from the face of the cab. The bumper will be 102.00" wide with 45 degree corners and side plates. The bumper will be metal finished and painted job color. To provide adequate support strength, the bumper will be mounted directly to the front of the C channel frame. The frame will be a bolted modular extension frame constructed of 50,000 psi tensile steel. GRAVEL PAN A gravel pan, constructed of bright aluminum treadplate, will be furnished between the bumper and the cab face. The pan will be properly supported from the underside to prevent flexing and vibration. Documentation will be provided, upon request, to show that the options selected have been engineered for fit-up and approval for this modular bumper extension. A chart will be provided to indicate the option locations and will include, but not be limited to, the following options: air horns, mechanical sirens, speakers, hose trays (with hose capacities), winches, lights, discharge and suction connections. 0616482 Tray, Hose, Center, 22" Bumper, Outside Air Horns, Imp/Vel CENTER HOSE TRAY A hose tray, constructed of aluminum, will be placed in the center of the bumper extension. The tray will have a capacity of 150' of 1.75" double jacket cotton-polyester hose. Black rubber grating will be provided at the bottom of the tray. Drain holes are also provided. 0630809 Cover, Aluminum Treadplate, One (1) D-Ring Latch, Hose Tray, Notched CENTER HOSE TRAY COVER A bright aluminum treadplate cover will be provided over the center hose tray. The cover will be "notched" allowing the hose to be pre connected to hose connection. The cover will be attached with a stainless steel hinge. A D-ring latch will secure the cover in the closed position and a mechanical stay arm will hold the cover in the open position. 0510226 Lift & Tow Package, Imp/Vel, AXT, Dash CF LIFT AND TOW MOUNTS Mounted to the frame extension will be lift and tow mounts. The lift and tow mounts will be designed and positioned to adapt to certain tow truck lift systems. The lift and tow mounts with eyes will be painted the same color as the frame. 0032932 Tow Eyes, Painted, Extended Out Front of Bumper TOW EYES Two (2) tow eyes will be mounted through the front face of the bumper. The inner and outer edges of the tow eyes will have a .25" radius. The tow eyes will be mounted directly to the bumper frame. Cutouts will be provided in the front face of the stainless steel bumper to allow the tow eyes to extend out the front. The tow eyes will be designed and positioned to allow up to a 9,000 lb straight horizontal pull in line with the centerline of the vehicle. The tow eyes will not be used for lifting of the apparatus. The tow eyes will be painted job color. 10751Bid #: 0668314 Cab, Velocity FR, 7010 Raised Roof w/Notch CAB The Velocity cab will be designed specifically for the fire service and will be manufactured by Pierce Manufacturing. To provide quality at the source and single source customer support, the cab will be built by the apparatus manufacturer in a facility located on the manufacturer's premises. For reasons of structural integrity and enhanced occupant protection, the cab will be of heavy duty design, constructed to the following minimal standards. The cab will have 12 main vertical structural members located in the A-pillar (front cab corner posts), B-pillar (side center posts), C-pillar (rear corner posts) and rear wall areas. The A-pillar will be constructed of 0.25" heavy wall extrusions joined by a solid A356-T6 aluminum joint casting. The B-pillar and C-pillar will also be constructed from 0.25" heavy wall extrusions. The rear wall will be constructed of two (2) 4.00" x 2.00" outer aluminum extrusions and two (2) 3.00" x 2.00" inner aluminum extrusions. All main vertical structural members will run from the floor to 7.50" x 3.50" x 0.125" thick roof extrusions to provide a cage-like structure with the A-pillar and roof extrusions being welded into a 0.75" thick corner casting at each of the front corners of the roof assembly. The front of the cab will be constructed of a 0.25" thick firewall, covered with a 0.125" front skin (for a total thickness of 0.38"), and reinforced with 24.50" wide x 10.00" deep x 0.50" thick supports on each side of the engine tunnel. The cross-cab support will be welded to the A-pillar, 0.25" firewall, and engine tunnel, on the left and right sides. The cab floors will be constructed of 0.1875" thick aluminum plate and reinforced at the firewall with an additional 0.25" thick cross-floor support providing a total thickness of 0.44" of structural material at the front floor area. The front floor area will also be supported with three (3) 0.50" plates bolted together that also provides the mounting point for the cab lift. This tubing will run from the front of the cab to the 0.1875" thick engine tunnel, creating the structure to support the forces created when lifting the cab. The cab will be a full-tilt style. A 3-point cab mount system with rubber isolators will improve ride quality by isolating chassis vibrations from the cab. The crew cab will be a totally enclosed design with the interior area completely open to improve visibility and verbal communication between the occupants. The forward cab section will have an overall height (from the cab roof to the ground) of approximately 102.00". The crew cab section will have a 10.00" raised roof, with an overall cab height of approximately 112.00". The raised portion will start at the most forward point of the B- pillar and continue rearward to the back of the cab. The overall height listed will be calculated based on a truck configuration with the lowest suspension weight ratings, the smallest diameter tires for the suspension, no water weight, no loose equipment weight, and no personnel weight. Larger tires, wheels, and suspension will increase the overall height listed. The raised roof section of the crew cab will have a 58.00" wide x 10.00" high square notch in the center section of the roof. This will allow the aerial device to be bedded in the same location as a non-raised roof. The cab will have an interior width of not less than 93.50". The driver and passenger seating positions will have a minimum 24.00" clear width at knee level. To reduce injuries to occupants in the seated positions, proper head clearance will be provided. The floor-to-ceiling height inside the forward cab will be no less than 60.25". The floor-to-ceiling height inside the crew cab will be no less than 52.95" in the center position and 68.75" in the outboard positions. The crew cab will measure a minimum of 57.50" from the rear wall to the backside of the engine tunnel (knee level) for optimal occupant legroom. INTERIOR CAB INSULATION The cab walls, ceiling and engine tunnel will be insulated in all strategic locations to maximize acoustic absorption and thermal insulation. The cab will be insulated with 2.00" insulation in the rear wall, 3.00" insulation in the side walls, and 1.50" insulation in the ceiling. FENDER LINERS Full-circular, aluminum inner fender liners in the wheel wells will be provided. PANORAMIC WINDSHIELD A one (1)-piece, safety glass windshield with more than 2,802 square inches of clear viewing area will be provided. The windshield will be full width and will provide the occupants with a panoramic view. The windshield will consist of three (3) layers: the outer light, the middle safety laminate, and the inner light. The 0.114" thick outer light layer will provide superior chip resistance. The middle safety laminate layer will prevent the windshield glass pieces from detaching in the event of breakage. The inner light will provide yet another chip resistant layer. The cab windshield will be bonded to the aluminum windshield frame using a urethane adhesive. A custom frit pattern will be applied on the outside perimeter of the windshield for a finished automotive appearance. WINDSHIELD WIPERS Three (3) electric windshield wipers with a washer, in conformance with FMVSS and SAE requirements, will be provided. The wiper blades will be 21.65" long and together will clear a minimum of 1,783 square inches of the windshield for maximum visibility in inclement weather. The windshield washer fluid reservoir will be located at the front of the vehicle and be accessible through the access hood for simple maintenance. FAST SERVICE ACCESS FRONT TILT HOOD A full-width access hood will be provided for convenient access to engine coolant, steering fluid, wiper fluid, cab lift controls, headlight power modules, and ember separator. The hood will also provide complete access to the windshield wiper motor and components. The hood will be contoured to provide a sleek, automotive appearance. The hood will be constructed of two (2) fiberglass panels bonded together and will include reinforcing ribs for structural integrity. The hood will include air cylinders to hold the hood in open and closed positions, and a heavy duty latch system that will meet FMVSS 113 (Hood Latch System). The spring-loaded hood latch will be located at the center of the hood with a double-action release lever located behind the Pierce logo. The two (2)-step release requires the lever first be pulled to the driver side until the hood releases from the first latch (primary latch) then to the passenger side to fully release the hood (secondary latch). 11751Bid #: 0667982 Engine Tunnel, ISX, Impel/Velocity FR ENGINE TUNNEL To provide structural strength, the engine tunnel sidewalls will be constructed of .50" aluminum plate that is welded to both the .25" firewall and .38" heavy wall extrusion under the crew cab floor. To maximize occupant space, the top edges will be tapered. The engine tunnel will be insulated on both sides for thermal and acoustic absorption. The underside of the tunnel will be covered with 1.00" thick polyether foam that is reinforced with an aluminized face. Thermal rating for this insulation will be -40 degrees Fahrenheit to 300 degrees Fahrenheit. The insulation will keep noise (dBA) levels at or lower than the specifications in the current edition of the NFPA 1901 standards. 0677478 Rear Wall, Exterior, Cab, Aluminum Treadplate CAB REAR WALL EXTERIOR COVERING The exterior surface of the rear wall of the cab will be overlaid with bright aluminum treadplate except for areas that are not typically visible when the cab is lowered. 0122466 Cab Lift, Elec/Hyd, w/Manual Override, Imp/Vel CAB LIFT A hydraulic cab lift system will be provided, consisting of an electric-powered hydraulic pump, fluid reservoir, dual lift cylinders, remote cab lift controls and all necessary hoses and valves. The hydraulic pump will have a backup manual override, for use in the event of an electrical failure. The cab lift controls will be located at the driver side front of the cab, easily accessible under the full width front access hood. The controls will include a permanently mounted raise/lower switch. For enhanced visibility during cab tilt operations, a remote control tether with on/off switch will be supplied on a coiled cord that will extend from 2.00' (coiled) to 6.00' (extended). The cab will be capable of tilting 42 degrees and 80 degrees with crane assist to accommodate engine maintenance and removal. The cab pivots will be located 46.00" apart to provide stability while tilting the cab. The rear of the cab will be locked down by a two (2)-point, automatic, hydraulic, double hook mechanism that fully engages after the cab has been lowered (self-locking). The dual 2.25" diameter hydraulic cylinders will be equipped with a velocity fuse that protects the cab from accidentally descending when the cab is in the tilt position. For increased safety, a redundant mechanical stay arm will be provided that must be manually put in place on the driver side between the chassis and cab frame when cab is in the raised position. This device will be manually stowed to its original position before the cab can be lowered. Cab Lift Interlock The cab lift safety system will be interlocked to the parking brake. The cab tilt mechanism will be active only when the parking brake is set and the ignition switch is in the on position. If the parking brake is released, the cab tilt mechanism will be disabled. 0123176 Grille, Bright Finished, Front of Cab, Impel/Velocity GRILLE A bright finished aluminum mesh grille screen, inserted behind a formed bright finished grille surround, will be provided on the front center of the cab, and will serve as an air intake to the radiator. 0002224 Scuffplates, S/S At Cab Door Jambs, 4-Door Cab DOOR JAMB SCUFFPLATES All cab door jambs will be furnished with a polished stainless steel scuffplate, mounted on the striker side of the jamb. 0646179 Trim, S/S, Rect Headlights, VEL/IMP FRONT CAB TRIM There will be polished stainless steel rectangular garnish plates installed behind the two (2) headlight bezels for an enhanced appearance. There will be no covers provided over the painted cab corner where the cab turn signals are located. 0015440 No Chrome Molding, On side of cab 0521669 Mirrors, Retrac, West Coast Style, Htd/Rmt, w/Htd/Rmt Convex MIRRORS A Retrac, Model 613423, dual vision, motorized, west coast style mirror, with chrome finish, will be mounted on each side of the front cab door with spring loaded retractable arms. The flat glass and convex glass will be heated and adjustable with remote control within reach of the driver. 12751Bid #: 0667937 Door, Full Height, Velocity FR 4-Door Cab, Raised Roof CAB DOORS To enhance entry and egress to the cab, the forward cab doors will be a minimum of 43.59" wide x 76.46" high. The crew cab doors will be located on the sides of the cab and will be constructed in the same manner as the forward cab doors. The crew cab doors will measure a minimum of 37.87" wide x 85.50" high. The forward cab and crew cab doors will be constructed of extruded aluminum with a nominal material thickness of 0.125". The exterior door skins will be constructed from 0.090" aluminum. The forward cab door windows will include a 7.50" high x 10.00" wide drop area at the front to enhance visibility. A customized, vertical, pull-down type door handle will be provided on the exterior of each cab door. The exterior handle will be designed specifically for the fire service to prevent accidental activation, and will provide 4.00" wide x 2.00" deep hand clearance for ease of use with heavy gloved hands. Each door will also be provided with an interior flush, open style paddle handle that will be readily operable from fore and aft positions, and be designed to prevent accidental activation. The interior handles will provide 4.00" wide x 1.25" deep hand clearance for ease of use with heavy gloved hands. The cab doors will be provided with both interior (rotary knob) and exterior (keyed) locks exceeding FMVSS standards. The keys will be Model 751. The locks will be capable of activating when the doors are open or closed. The doors will remain locked if locks are activated when the doors are opened, then closed. A heavy duty, stainless steel, piano-type hinge with a 0.38" pin and 11 gauge leaf will be provided on all cab doors. There will be double automotive-type rubber seals around the perimeter of the door framing and door edges to ensure a weather-tight fit. A chrome grab handle will be provided on the inside of each cab and crew cab door. The cab steps at each cab door location will be located inside the cab doors to protect the steps from weather elements. 0655511 Door Panel, Brushed Stainless Steel, Impel/Velocity 4-Door Cab CAB DOOR PANELS The inner cab door panels will be constructed out of brushed stainless steel. The cab door panels will be removable. 0667905 Storage Pockets w/ Elastic Cover, Recessed, Impel/Velocity FR RECESSED POCKET WITH ELASTIC COVER To provide organized storage (clutter control) in the cab for miscellaneous equipment, the cab interior will be provided with recessed storage pockets. The pockets will be 5.63" wide x 2.00" high x 4.00" deep. The pockets will be provided with a perforated elastic material cover to secure the equipment in the pocket. The pockets will be installed in all available mounting locations of the overhead console. 0667902 Controls, Electric Windows, All Cab Doors, Impel/Velocity FR ELECTRIC WINDOW CONTROLS Each cab entry door will be equipped with an electrically operated tempered glass window. A window control panel will be located on the door panel within easy reach of the respective occupant. Each switch will allow intermittent or auto down operation for ease of use. Auto down operation will be actuated by holding the window down switch for approximately 1 second. The driver control panel will contain a control switch for each cab door's window. All other door control panels will contain a single switch to operate the window within that door. The window switches will be connected directly to the battery power. This allows the windows to be raised and lowered when the battery switch is in the off position. 0662776 Electric Door Locks, Cab Doors, Conceal Switch Feature, Imp/Vel ELECTRIC CAB DOOR LOCKS The front driver and passenger doors will have a door lock master switch (custom designed rotary lock knob) built into the interior door latch that will control all front and rear side exit door locks. Each rear cab door will have its own lock control. Each door will have a keyed exterior lock mechanism built into the door handle assembly. There will be one (1) concealed switch located front bumper. The lock system will include two (2) key FOBs that allow for keyless entry into the vehicle. The key FOB system will use code hopping technology for high security and be FCC part 15 compliant. 0512420 Key Pad, Electric Door locks, DS & PS, Imp/Vel KEY PAD FOR ELECTRIC DOOR LOCKS For improved convenience, the cab door locks will include a Trimark keypad entry system to provide complete keyless entry to the cab. There will be two (2) keypads provided, located one each side of the cab behind the front cab doors. The keypads will include visual and audio feedback to confirm activation and acknowledge correct entry code. For enhanced night time use, the keypads will be lighted. For increased security, the system will allow over 3000 possible code combinations. 0555485 Steps, 4-Door Full Tilt Cab, Imp/Vel CAB STEPS The forward cab and crew cab access steps will be a full size two (2) step design to provide largest possible stepping surfaces for safe ingress and egress. The bottom steps will be designed with a grip pattern punched into bright aluminum treadplate material to provide support, slip resistance, and drainage. The bottom steps will be a bolt-in design to minimize repair costs should they need to be replaced. The forward cab steps will be a minimum 31.00" wide, and the crew cab steps will be 24.25" wide with an 8.00" minimum depth. The inside cab steps will not exceed 18.00" in height and be limited to two (2) steps. 13751Bid #: 0770200 Handrail, Exterior, Hansen, Knurled, Alum, LED Backlit, 4-Door Cab CAB EXTERIOR HANDRAILS A Hansen knurled aluminum handrail will be provided adjacent to each cab and crew cab door opening to assist during cab ingress and egress. Each handrail will be provided with white LED lights. The lights will be activated when the parking brake is applied. The LED lights may be load managed. 0566180 Steps, Stirrup, Cab Doors, Imp/Vel STIRRUP STEPS A stirrup step will be provided below each front cab door. The steps will be designed with a grip pattern punched into bright aluminum treadplate material providing support, slip resistance, and drainage. The steps will be a bolt-on design and provide a 18.50" wide x 5.00" deep stepping surface. Each step will provide a step height of 8.25" from the top of the stirrup step to the first step of the cab. The stirrup step will be lit by a white 12 volt DC LED light provided on the step. The step light will be activated automatically when the battery switch is on and the exit doors are opened or by the same means as the body step lights. 0509649 Lights, Cab and Crew Cab Access Steps, P25, LED w/Bezel, 1Lt Per Step STEP LIGHTS For reduced overall maintenance costs compared to incandescent lighting, there will be four (4) white LED step lights provided. The lights will be installed at each cab and crew cab door, one (1) per step. The lights will be located in the driver side front doorstep, driver side crew cab doorstep, passenger side front doorstep and passenger side crew cab doorstep. In order to ensure exceptional illumination, each light will provide a minimum of 25 foot-candles (fc) covering an entire 15.00" x 15.00" square placed 10.00" below the light and a minimum of 1.5 fc covering an entire 30.00" x 30.00" square at the same 10.00" distance below the light. The lights will be activated when the adjacent door is opened. 0002140 Fenders, S/S on Cab FENDER CROWNS Stainless steel fender crowns will be installed at the cab wheel openings. 0592071 No Windows, Side of Crew Cab, Vel/Imp 0568605 Not Required, Interior Trim, No Cab Side Windows 0012090 Not Required, Windows, Front/Side of raised roof 0509286 Not Required, Windows Rear of Crew Cab, Imp/Vel 0558334 Not Required, Trim, Cab Rear Windows, No Rear Windows 0651515 Window Protector Bars, Knurled, Crew Doors, 2" Above Window Sill Plate WINDOW PROTECTOR BARS, CREW CAB DOORS A knurled window protector bar will be installed on each crew cab door, 2.00" above the bottom of the window opening. The bar will extend from the front of the crew cab door to the rear of the crew cab door, mounted as close to the door frame as possible. 0782446 SP Compt, Storage, 10.71 W x 30 H x 14 D, (1) Ea Side C/C, Rev Hng, D-Ring, Imp/Vel STORAGE COMPARTMENTS Provided on each side of the cab, to the rear of the crew cab access doors, will be a storage compartment. The compartments will be approximately 10.71" wide x 30.00" high x 14.00" deep with a clear door opening of 9.50" wide x 28.00" high. The doors will be a reverse hinged, painted single pan construction with one (1) D-ring latch. A cable will be used as a door stop. The compartment interior will be painted to match the cab interior. Compartment Light There will be no lights required in the compartments. 14751Bid #: 0667945 Cab Interior, Vinyl, Velocity FR, CARE CAB INTERIOR With safety as the primary objective, the wrap-around style cab instrument panel will be designed with unobstructed visibility to instrumentation. The dash layout will provide the driver with a quick reference to gauges that allows more time to focus on the road. The center console will be a high impact ABS polymer and will be easily removable for access to the defroster. The center console will include louvers strategically located for optimal air flow and defrost capability to the windshield. The passenger side dashboard will be constructed of painted aluminum for durability and low maintenance. For enhanced versatility, the passenger side dash will include a flat working surface. To provide optional (service friendly) control panels, switches and storage modules, a painted aluminum overhead console will also be provided. To complete the cab front interior design, painted aluminum modesty panels will be provided under the dash on both sides of the cab. The driver side modesty panel will provide mounting for the battery switch and diagnostic connectors, while the passenger side modesty panel provides a glove box, and ground access to the main electrical distribution panel via quick quarter turn fasteners. To provide a deluxe automotive interior, the engine tunnel, side walls and rear wall will be covered by a leather grain vinyl that is resistant to oil, grease, and mildew. The headliner will be installed in both forward and rear cab sections. The headliner panel will be a composition of an aluminum panel covered with a sound barrier and upholstery. The cab structure will include designated raceways for electrical harness routing from the front of the cab to the rear upper portion of the cab. Raceways will be extruded in the forward door frame, floor, walls and overhead in the area where the walls meet the ceiling. The raceways located in the floor will be covered by aluminum extrusion, while the vertical and overhead raceways will be covered by painted aluminum covers. The raceways will improve harness integrity by providing a continuous harness path that eliminates wire chafing and abrasion associated with exposed wiring or routing through drilled metal holes. Harnesses will be laid in place. CAB INTERIOR UPHOLSTERY The cab interior upholstery will be dark silver gray. All cab interior materials will meet FMVSS 302 (flammability of interior materials). 0667943 Cab Interior, Paint Color, Impel/Velocity FR CAB INTERIOR PAINT A rich looking interior will be provided by painting all the metal surfaces inside the cab red, vinyl texture paint. 0509532 Floor, Rubber Padded Cab & Crew Cab, Imp/Vel, Dash CF CAB FLOOR The cab and crew cab floor areas will be covered with Polydamp™ acoustical floor mat consisting of a black pyramid rubber facing and closed cell foam decoupler. The top surface of the material has a series of raised pyramid shapes evenly spaced, which offer a superior grip surface. Additionally, the material has a 0.25" thick closed cell foam (no water absorption) which offers a sound dampening material for reducing sound levels. 0667936 Heater/defroster, Dual Zone Control, Impel/Velocity FR CAB DEFROSTER To provide maximum defrost and heating performance, a 54,961 BTU heater-defroster unit with 558 SCFM of air flow will be provided inside the cab. The defroster unit will be strategically located under the center forward portion of the instrument panel. For easy access, a removable metal cover will be installed over the defroster unit. The defroster will include an integral aluminum frame air filter, high performance dual scroll blowers, and ducts designed to provide maximum defrosting capabilities for the 1-piece windshield. The defroster ventilation will be built into the design of the cab dash instrument panel and will be easily removable for maintenance. The defroster will be capable of clearing 98 percent of the windshield and side glass when tested under conditions where the cab has been cold soaked at 0 degrees Fahrenheit for 10 hours, and a 2 ounce per square inch layer of frost/ice has been able to build up on the exterior windshield. The defroster system will meet or exceed SAE J382 requirements. CAB/CREW CAB HEATER Two (2) 36,702 BTU auxiliary heaters with 276 SCFM (each unit) of air flow will be provided inside the crew cab, one (1) in each outboard rear facing seat riser. The heaters will include high performance dual scroll blowers, one (1) for each unit. Outlets for the heaters will be located below each rear facing seat riser and below the fronts of the driver and passenger seats, for efficient airflow. An extruded aluminum plenum will be incorporated in the cab structure that will transfer heat to the forward cab seating positions. The heater/defroster and crew cab heaters will be controlled by an integral electronic control panel. The heater control panel will allow the driver to control heat flow to the front and rear independently. The control panel will include variable adjustment for temperature and fan control, and be conveniently located on the dash in clear view of the driver. The control panel will include highly visible, progressive LED indicators for both fan speed and temperature. 15751Bid #: 0603346 Air Conditioning, Dual Zone Control, Hinge Acc Panel, Impel/Velocity FR AIR CONDITIONING Due to the large space inside the cab, a high-performance, customized air conditioning system will be furnished. A 19.10 cubic inch compressor will be installed on the engine. The air conditioning system will be capable of cooling the average cab temperature from 100 degrees Fahrenheit to 64 degrees Fahrenheit in the forward section of the cab, and 69 degrees Fahrenheit in the rear section of the cab, at 50 percent relative humidity within 30 minutes. The cooling performance test will be run only after the cab has been heat soaked at 100 degrees Fahrenheit for a minimum of 4 hours. A roof-mounted condenser with a 63,000 BTU output that meets and exceeds the performance specification will be installed on the cab roof. The condenser cover and mounting legs to be painted white as provided by the A/C manufacturer. The evaporator unit will be installed in the rear portion of the cab ceiling over the engine tunnel. The evaporator will include two (2) high performance cores and plenums with multiple outlets, one (1) plenum directed to the front and one (1) plenum directed to the rear of the cab. There will be a hinge on the forward edge of the filter cover and two (2) quarter turn fasteners with a knob on the rear edge to allow easy access. The evaporator unit will have a 49,000 BTU (4.08 tons) rating that meets and exceeds the performance specifications. Adjustable air outlets will be strategically located on the evaporator cover per the following: Four (4) will be directed towards the drivers location Four (4) will be directed towards the officers location Eight (8) will be directed towards crew cab area The air conditioner refrigerant will be R-134A and will be installed by a certified technician. The air conditioner will be controlled by dual zone integral electronic control panels for the heater, defroster and air conditioner. The cab control panel will be located in the center console. For ease of operation, the control panels will include variable adjustment for temperature and fan control. INTERIOR CAB INSULATION The cab walls, ceiling and engine tunnel will be insulated in all strategic locations to maximize acoustic absorption and thermal insulation. The cab will be insulated with 2.00" insulation in the rear wall, 3.00" insulation in the side walls, and 1.50" insulation in the ceiling. Headliners will be constructed from a 0.20" high density polyethylene corrugated material. Each headliner will be wrapped with a 0.25" thick foil faced poly damp low emissivity foam insulation barrier for acoustic and thermal control. Designed for maximum sound absorption and thermal insulation, the rear cab wall will be insulated with a 1.50" thick open cell acoustical foam. The thermal protection of the foam will provide and R-value of 4 per 1.00" thickness. 0545846 Air Conditioning, Dometic, Split System AIR CONDITIONER A Dometic, Model ECEQ14-CEB, auxiliary remote split air conditioning system will be provided for additional cooling of the cab interior. The evaporator unit, consisting of the evaporator, blower and compressor, will be located tbd. The condenser will be mounted on the cab roof. The air conditioner will have a cooling capacity of 14,000 BTU. The unit will be 120 volt AC. The full load amperage draw will be 14.5 amps in the cooling mode. The unit will be powered from the shoreline inlet. A thermostat will control the cooling unit, located within the crew cab, rear face of the center console. 0640814 Dual Condensate Drain Tubes for A/C Drip Pan, Imp/Vel FR SPECIAL DRAIN TUBES Two (2) condensate drain tubes will be provided for the air conditioning evaporator. The drip pan will have two (2) drain tubes plumbed separately to allow for the condensate to exit the drip pan. 0639675 Sun Visor, Smoked Lexan, AXT, Dash CF, Imp/Vel, Saber FR/Enforcer SUN VISORS Two (2) smoked Lexan™ sun visors provided. The sun visors will be located above the windshield with one (1) mounted on each side of the cab. There will be no retention bracket provided to help secure each sun visor in the stowed position. 0543257 Grab Handles, Driver Door Post & Passenger Dash Panel, Imp/Vel GRAB HANDLE A black rubber covered grab handle will be mounted on the door post of the driver side cab door to assist in entering the cab. The grab handle will be securely mounted to the post area between the door and windshield. A long rubber grab handle will be mounted on the dash board in front of the officer. 0583938 Lights, Engine Compt, Custom, Auto Sw, Wln 3SC0CDCR, 3" LED, Trim ENGINE COMPARTMENT LIGHTS There will be one (1) Whelen, Model 3SC0CDCR, 12 volt DC, 3.00" white LED light(s) with Whelen, Model 3FLANGEC, chrome flange kit(s) installed under the cab to be used as engine compartment illumination. These light(s) will be activated automatically when the cab is raised. 16751Bid #: 0122516 Fluid Check Access, Imp/Vel ACCESS TO ENGINE DIPSTICKS For access to the engine oil and transmission fluid dipsticks, there will be a door on the engine tunnel, inside the crew cab. The door will be on the rear wall of the engine tunnel, on the vertical surface. The door will be 17.75" wide x 12.75" high and be flush with the wall of the engine tunnel. The engine oil dipstick will allow for checking only. The transmission dipstick will allow for both checking and filling. An additional port will be provided for filling the engine oil. The door will have a rubber seal for thermal and acoustic insulation. One (1) flush latch will be provided on the access door. 0000000 STF Center Cab Console with Cup Holders-SEMG Furnished CENTER CAB CONSOLE WITH CUP HOLDERS-DEALER FURNISHED There shall be a custom console installed on the apparatus engine tunnel. This console shall be constructed of high density poly propylene. The design and layout shall be approved by the fire department. 0583042 Side Roll and Frontal Impact Protection CAB SAFETY SYSTEM The cab will be provided with a safety system designed to protect occupants in the event of a side roll or frontal impact, and will include the following: A supplemental restraint system (SRS) sensor will be installed on a structural cab member behind the instrument panel. The SRS sensor will perform real time diagnostics of all critical subsystems and will record sensory inputs immediately before and during a side roll or frontal impact event. A slave SRS sensor will be installed in the cab to provide capacity for eight (8) crew cab seating positions. A fault-indicating light will be provided on the vehicle's instrument panel allowing the driver to monitor the operational status of the SRS system. A driver side front air bag will be mounted in the steering wheel and will be designed to protect the head and upper torso of the occupant, when used in combination with the 3-point seat belt. A passenger side knee bolster air bag will be mounted in the modesty panel below the dash panel and will be designed to protect the legs of the occupant, when used in combination with the 3-point seat belt. Air curtains will be provided in the outboard bolster of outboard seat backs to provide a cushion between occupant and the cab wall. Suspension seats will be provided with devices to retract them to the lowest travel position during a side roll or frontal impact event. Seat belts will be provided with pre-tensioners to remove slack from the seat belt during a side roll or frontal impact event. FRONTAL IMPACT PROTECTION The SRS system will provide protection during a frontal or oblique impact event. The system will activate when the vehicle decelerates at a predetermined G force known to cause injury to the occupants. The cab and chassis will have been subjected, via third party test facility, to a crash impact during frontal and oblique impact testing. Testing included all major chassis and cab components such as mounting straps for fuel and air tanks, suspension mounts, front suspension components, rear suspensions components, frame rail cross members, engine and transmission and their mounts, pump house and mounts, frame extensions and body mounts. The testing provided configuration specific information used to optimize the timing for firing the safety restraint system. The sensor will activate the pyrotechnic devices when the correct crash algorithm, wave form, is detected. The SRS system will deploy the following components in the event of a frontal or oblique impact event: Driver side front air bag Passenger side knee bolster air bag Air curtains mounted in the outboard bolster of outboard seat backs Suspension seats will be retracted to the lowest travel position Seat belts will be pre-tensioned to firmly hold the occupant in place SIDE ROLL PROTECTION The SRS system will provide protection during a fast or slow 90 degree roll to the side, in which the vehicle comes to rest on its side. The system will analyze the vehicle's angle and rate of roll to determine the optimal activation of the advanced occupant restraints. The SRS system will deploy the following components in the event of a side roll: Air curtains mounted in the outboard bolster of outboard seat backs Suspension seats will be retracted to the lowest travel position Seat belts will be pre-tensioned to firmly hold the occupant in place 0622618 Seating Capacity, 5 Seats SEATING CAPACITY The seating capacity in the cab will be five (5). 17751Bid #: 0697005 Seat, Driver, Pierce PS6, Premium, Air Ride, High Back, Safety DRIVER SEAT A Pierce PS6® seat will be provided in the cab for the driver. The seat design will be a cam action type with air suspension. For increased convenience, the seat will include electric controls to adjust the rake (15 degrees), height (1.75" travel) and horizontal (7.00" travel) position. Electric controls will be located below the forward part of the seat cushion. To provide flexibility for multiple driver configurations, the seat will have a reclining back, adjustable from 20 degrees back to 45 degrees forward. Providing for maximum comfort, the seat back will be a high back style with manual lumbar adjustment lever, for lower back support, and will include minimum 7.50" deep side bolster pads for maximum support. The lumbar adjustment lever will be easily located at the lower outboard position of the seat cushion. For optimal comfort, the seat will be provided with 17.00" deep dual density foam cushions designed with EVC (elastomeric vibration control). The seat will include the following features incorporated into the side roll protection system: Side air curtain will be mounted integral to the outboard bolster of the seat back. The air curtain will be covered by a decorative panel when in the stowed position. A suspension seat safety system will be included. When activated in the event of a side roll, this system will pretension the seat belt and retract the seat to its lowest travel position. The seat will be furnished with a 3-point, shoulder type seat belt. The seat belt will be furnished with dual automatic retractors that will provide ease of operation in the normal seating position. 0696994 Seat, Officer, Pierce PS6, Premium, Air Ride, SCBA, Safety OFFICER SEAT A Pierce PS6® seat will be provided in the cab for the passenger. The seat will be a cam action type with air suspension. For increased convenience, the seat will include a manual control to adjust the horizontal position (6.00" travel). The manual horizontal control will be a towel-bar style located below the forward part of the seat cushion. For optimal comfort, the seat will be provided with 17.00" deep dual density foam cushions designed with EVC (elastomeric vibration control). To ensure safe operation, the seat will be equipped with seat belt sensors in the seat cushion and belt receptacle that will activate an alarm indicating a seat is occupied but not belted. The seat back will be an SCBA back style with 7.5 degree fixed recline angle, and will include minimum 4.50" wide x 7.50" deep side bolster pads for maximum support. The SCBA cavity will be adjustable from front to rear in 1.00" increments, to accommodate different sized SCBA cylinders. Moving the SCBA cavity will be accomplished by unbolting, relocating, and re-bolting it in the desired location. The seat will include the following features incorporated into the side roll protection system: Side air curtain will be mounted integral to the outboard bolster of the seat back. The air curtain will be covered by a decorative panel when in the stowed position. A suspension seat safety system will be included. When activated, this system will pretension the seat belt and then retract the seat to its lowest travel position. The seat will be furnished with a 3-point, shoulder type seat belt. The seat belt will be furnished with dual automatic retractors that will provide ease of operation in the normal seating position. 0002517 Not Required, Radio Compartment 0771848 Cabinet, Rear Facing, LS, 24 W x 28 H x 30.5 D, Web, Ext Acc, Imp/Vel REAR FACING LEFT SIDE CABINET A rear facing cabinet will be provided in the crew cab at the left side outboard position with interior and exterior access. The cabinet will be 24.00" wide x 28.00" high x 30.50" deep. The interior door will be web netting. The netting is to be made with 1.00" wide nylon material with 2.00" openings. The interior clear door opening will be 19.50" wide x 24.50" high. The nylon webbing will be fastened with spring clip and hook fasteners on all sides to secure it. The cabinet will include one (1) infinitely adjustable shelf with a 0.75" up-turned lippainted to match the cab interior. The cabinet will include no louvers. The cabinet will also provide exterior access with one (1) double pan door painted to match the cab exterior with a locking D-ring latch with #751 key. A pneumatic stay arm will be provided as a door stop. The clear door opening will 20.00" wide x 25.75" high. The exterior access will be provided with a polished stainless steel scuffplate on the lower door frame. The cabinet will be constructed of smooth aluminum and painted to match the cab interior. Cabinet Light There will be one (1) white LED strip light installed on the right side of the interior cabinet door opening. The lights will be controlled by an automatic door switch and a rocker switch on the cabinet exterior. 0102783 Not Required, Seat, Rr Facing C/C, Center 18751Bid #: 0767512 Cabinet, Rear Facing, RS, 22 W x 28 H x 26.5 D, Web, Ext Acc, Imp/Vel REAR FACING RIGHT SIDE CABINET A rear facing cabinet will be provided in the crew cab at the right side outboard position. The cabinet will be 22.00" wide x 28.00" high x 26.50" deep. The interior door will be web netting. The netting is to be made with 1.00" wide nylon material with 2.00" openings. The nylon webbing will be permanently fastened at the bottom side of the cabinet and have spring clip and hook fasteners on the opposite side to secure it. The clear door opening will be 17.50" wide x 24.50" high. The cabinet will include one (1) infinitely adjustable shelf with a 0.75" up-turned lippainted to match the cab interior. The cabinet will include no louvers. The cabinet will also provide access from outside the cab with one (1) double pan door painted to match the cab exterior with a locking D-ring latch with #751 key. A pneumatic stay arm will be provided as a door stop. The exterior clear door opening will be 20.00" wide x 25.75" high. The door will be located on the side of the cab over the wheelwell. The exterior access will be provided with a polished stainless steel scuffplate on the lower door frame. The cabinet will be constructed of smooth aluminum, and painted to match the cab interior. Cabinet Light There will be one (1) white LED strip light installed on the left side of the interior cabinet door opening. The lights will be controlled by an automatic door switch and rocker switch on the exterior of the cabinet. 0645433 Seat, Forward Facing C/C, DS Outbrd, Pierce PS6, Base, SCBA, Safety, Inboard 3" FORWARD FACING DRIVER SIDE OUTBOARD SEAT There will be one (1) forward facing Pierce PS6® seat provided at the driver side outboard position in the crew cab. To provide improved ride comfort, and maximize accessibility to the crew cab, the seat will be provided with 15.00" deep foam cushions, and the seat back will be provided with 0 degree fixed recline angle. To ensure safe operation, the seat will be equipped with seat belt sensors in the seat cushion and belt receptacle, that will activate an alarm indicating a seat is occupied but not buckled. The seat back will be an SCBA back style. The SCBA cavity will be adjustable from front to rear in 1.00" increments, to accommodate different sized SCBA cylinders. Moving the SCBA cavity will be accomplished by unbolting, relocating, and re-bolting it in the desired location. The seat will include the following features incorporated into the side roll protection system: Side air curtain will be mounted integral to the outboard bolster of the seat back. The air curtain will be covered by a decorative panel when in the stowed position. A seat safety system will be included. When activated, this system will pretension the seat belt around the occupant to firmly hold them in place in the event of a side roll. The seat will be furnished with a 3-point, shoulder type seat belt. The seat belt will be furnished with dual automatic retractors that will provide ease of operation in the normal seating position. The seat will be moved approximately 3.00" inboard from the standard location. 0637508 Seat, Forward Facing C/C, Center, (1) Pierce PS6, Base, SCBA, 17" Btm, Safety FORWARD FACING CENTER SEAT There will be one (1) forward facing, Pierce PS6® seat provided at the center position in the crew cab. To provide improved ride comfort, and maximize accessibility to the crew cab, the seat will be provided with 17.00" deep foam cushions, and the seat back will be provided with 0 degree fixed recline angle. To ensure safe operation, the seat will be equipped with seat belt sensors in the seat cushion and belt receptacle that will activate an alarm indicating a seat is occupied but not buckled. The seat back will be an SCBA back style. The SCBA cavity will be adjustable from front to rear in 1.00" increments, to accommodate different sized SCBA cylinders. Moving the SCBA cavity will be accomplished by unbolting, relocating, and re-bolting it in the desired location. The seat will include the following feature incorporated into the side roll protection system: A seat safety system will be included. When activated, this system will pretension the seat belt around the occupant to firmly hold them in place in the event of a side roll. The seat will be furnished with a 3-point, shoulder type seat belt. The seat belt will be furnished with dual automatic retractors that will provide ease of operation in the normal seating position. 0645431 Seat, Forward Facing C/C, PS Outboard, Pierce PS6, Base, SCBA, Safety, Inbrd 3" FORWARD FACING PASSENGER SIDE OUTBOARD SEAT There will be one (1) forward facing Pierce PS6® seat provided at the passenger side outboard position in the crew cab. To provide improved ride comfort, and maximize accessibility to the crew cab, the seat will be provided with 15.00" deep foam cushions, and the seat back will be provided with 0 degree fixed recline angle. To ensure safe operation, the seat will be equipped with seat belt sensors in the seat cushion and belt receptacle, that will activate an alarm indicating a seat is occupied but not buckled. The seat back will be an SCBA back style. The SCBA cavity will be adjustable from front to rear in 1.00" increments, to accommodate different sized SCBA cylinders. Moving the SCBA cavity will be accomplished by unbolting, relocating, and re-bolting it in the desired location. The seat will include the following features incorporated into the side roll protection system: Side air curtain will be mounted integral to the outboard bolster of the seat back. The air curtain will be covered by a decorative panel when in the stowed position. A seat safety system will be included. When activated, this system will pretension the seat belt around the occupant to firmly hold them in place in the event of a side roll. The seat will be furnished with a 3-point, shoulder type seat belt. The seat belt will be furnished with dual automatic retractors that will provide ease of operation in the normal seating position. The seat will be moved approximately 3.00" inboard from the standard location. 0042359 Upholstery, Seats In Cab, All Vinyl, CARE SEAT UPHOLSTERY All seat upholstery will be 46 ounce leather grain dark silver gray vinyl resistant to oil, grease and mildew. The cab will have five (5) seating positions. 19751Bid #: 0543991 Bracket, Air Bottle, Hands-Free II, Cab Seats AIR BOTTLE HOLDERS All SCBA type seats in the cab will have a "Hands-Free" auto clamp style bracket in its backrest. For efficiency and convenience, the bracket will include an automatic spring clamp that allows the occupant to store the SCBA bottle by simply pushing it into the seat back. For protection of all occupants in the cab, in the event of an accident, the inertial components within the clamp will constrain the SCBA bottle in the seat and will exceed the NFPA standard of 9G. There will be a quantity of four (4) SCBA brackets. 0603867 Seat Belt, ReadyReach SEAT BELTS All seating positions in the cab, crew cab and tiller cab (if applicable) will have red seat belts. To provide quick, easy use for occupants wearing bunker gear, the female buckle and seat belt webbing length will meet or exceed the current edition of NFPA 1901 and CAN/ULC - S515 standards. The 3-point shoulder type seat belts will also include the ReadyReach D-loop assembly to the shoulder belt system. The ReadyReach feature adds an extender arm to the D-loop location placing the D-loop in a closer, easier to reach location. 0604864 Seat Belt Height Adjustment, 5 Seats, Imp/Vel, Dash CF SHOULDER HARNESS HEIGHT ADJUSTMENT All seating positions furnished with 3-point shoulder type seat belts will include a height adjustment. This adjustment will optimize the belts effectiveness and comfort for the seated firefighter. A total of five (5) seating positions will have the adjustable shoulder harness. 0602464 Helmet Storage, Provided by Fire Department, NFPA 2016 HELMET STORAGE PROVIDED BY FIRE DEPARTMENT NFPA 1901, 2016 edition, section 14.1.7.4.1 requires a location for helmet storage be provided. There is no helmet storage on the apparatus as manufactured. The fire department will provide a location for storage of helmets. 0647647 Lights, Dome, FRP Dual LED 4 Lts CAB DOME LIGHTS There will be four (4) dual LED dome lights with black bezels provided. Two (2) lights will be mounted above the inside shoulder of the driver and officer and two (2) lights will be installed and located, one (1) on each side of the crew cab. The color of the LED's will be red and white. The white LED's will be controlled by the door switches and the lens switch. The color LED's will be controlled by the lens switch. In order to ensure exceptional illumination, each white LED dome light will provide a minimum of 10.1 foot-candles (fc) covering an entire 20.00" x 20.00" square seating position when mounted 40.00" above the seat. 0631776 Not Required, Overhead Map Lights 0602622 Portable Hand Light, Provided by Fire Department, Quint NFPA 2016 Classification PORTABLE HAND LIGHTS, PROVIDED BY FIRE DEPARTMENT NFPA 1901, 2016 edition, section 9.9.4 requires two portable hand lights mounted in brackets fastened to the apparatus. The hand lights are not on the apparatus as manufactured. The fire department will provide and mount these hand lights. 0568369 Cab Instruments, Ivory Gauges, Chrome Bezels, Impel/Velocity 2010, Dash CF CAB INSTRUMENTATION The cab instrument panel will consist of gauges, an LCD display, telltale indicator lights, alarms, control switches, and a diagnostic panel. The function of instrument panel controls and switches will be identified by a label adjacent to each item. Actuation of the headlight switch will illuminate the labels in low light conditions. Telltale indicator lamps will not be illuminated unless necessary. The cab instruments and controls will be conveniently located within the forward cab section directly forward of the driver. Gauge and switch panels will be designed to be removable for ease of service and low cost of ownership. GAUGES The gauge panel will include the following ten (10) ivory gauges with chrome bezels to monitor vehicle performance: - Voltmeter gauge (Volts) Low volts (11.8 VDC) Amber indicator on gauge assembly with alarm High volts (15 VDC) Amber indicator on gauge assembly with alarm Very low volts (11.3 VDC) Amber indicator on gauge assembly with alarm Very high volts (16 VDC) Amber indicator on gauge assembly with alarm - Tachometer (RPM) - Speedometer (Primary (outside) MPH, Secondary (inside) Km/H) - Fuel level gauge (Empty - Full in fractions) Low fuel (1/8 full) Amber indicator on gauge assembly with alarm Very low fuel (1/32) fuel Amber indicator on gauge assembly with alarm - Engine oil pressure gauge (PSI) Low oil pressure to activate engine warning lights and alarms Red indicator on gauge assembly with alarm 20751Bid #: - Front air pressure gauge (PSI) Low air pressure to activate warning lights and alarm Red indicator on gauge assembly with alarm - Rear air pressure gauge (PSI) Low air pressure to activate warning lights and alarm Red indicator on gauge assembly with alarm - Transmission oil temperature gauge (Fahrenheit) High transmission oil temperature activates warning lights and alarm Amber indicator on gauge assembly with alarm - Engine coolant temperature gauge (Fahrenheit) High engine temperature activates an engine warning light and alarm Red indicator on gauge assembly with alarm - Diesel Exhaust Fluid Level Gauge (Empty - Full in fractions) Low fluid (1/8 full) Amber indicator on gauge assembly with alarm All gauges and gauge indicators will perform prove out at initial power-up to ensure proper performance. INDICATOR LAMPS To promote safety, the following telltale indicator lamps will be integral to the gauge assembly and are located above and below the center gauges. The indicator lamps will be "dead-front" design that is only visible when active. The colored indicator lights will have descriptive text or symbols. The following amber telltale lamps will be present: - Low coolant - Trac cntl (traction control) (where applicable) - Check engine - Check trans (check transmission) - Aux brake overheat (Auxiliary brake overheat) - Air rest (air restriction) - Caution (triangle symbol) - Water in fuel - DPF (engine diesel particulate filter regeneration) - Trailer ABS (where applicable) - Wait to start (where applicable) - HET (engine high exhaust temperature) (where applicable) - ABS (antilock brake system) - MIL (engine emissions system malfunction indicator lamp) (where applicable) - SRS (supplemental restraint system) fault (where applicable) - DEF (low diesel exhaust fluid level) The following red telltale lamps will be present: - Warning (stop sign symbol) - Seat belt - Parking brake - Stop engine - Rack down The following green telltale lamps will be provided: - Left turn - Right turn - Battery on The following blue telltale lamp will be provided: - High beam ALARMS Audible steady tone warning alarm: A steady audible tone alarm will be provided whenever a warning message is present. Audible pulsing tone caution alarm: A pulsing audible tone alarm (chime/chirp) will be provided whenever a caution message is present without a warning message being present. Alarm silence: Any active audible alarm will be able to be silenced by holding the ignition switch at the top position for three (3) to five (5) seconds. For improved safety, silenced audible alarms will intermittently chirp every 30 seconds until the alarm condition no longer exists. The intermittent chirp will act as a reminder to the operator that a caution or warning condition still exists. Any new warning or caution condition will enable the steady or pulsing tones respectively. INDICATOR LAMP AND ALARM PROVE-OUT Telltale indicators and alarms will perform prove-out at initial power-up to ensure proper performance. CONTROL SWITCHES For ease of use, the following controls will be provided immediately adjacent to the cab instrument panel within easy reach of the driver. Emergency master switch: A molded plastic push button switch with integral indicator lamp will be provided. Pressing the switch will activate emergency response lights and siren control. A green lamp on the switch provides indication that the emergency master mode is active. Pressing the switch again disables the emergency master mode. Headlight / Parking light switch: A three (3)-position maintained rocker switch will be provided. The first switch position will deactivate all parking lights and the headlights. The second switch position will activate the parking lights. The third switch position will activate the headlights. Panel backlighting intensity control switch: A three (3)-position momentary rocker switch will be provided. The first switch position decreases the panel backlighting intensity to a minimum level as the switch is held. The second switch position is the default position that does not affect the backlighting intensity. The third switch position increases the panel backlighting intensity to a maximum level as the switch is held. The following standard controls will be integral to the gauge assembly and are located below the right hand gauges. All switches have backlit labels for low light applications. High idle engagement switch: A two (2)-position momentary rocker switch with integral indicator lamp will be provided. The first switch position is the default switch position. The second switch position will activate and deactivate the high idle function when pressed and released. The "Ok To Engage High Idle" indicator lamp must be active for the 21751Bid #: high idle function to engage. A green indicator lamp integral to the high idle engagement switch will indicate when the high idle function is engaged. "Ok To Engage High Idle" indicator lamp: A green indicator light will be provided next to the high idle activation switch to indicate that the interlocks have been met to allow high idle engagement. The following standard controls will be provided adjacent to the cab gauge assembly within easy reach of the driver. All switches will have backlit labels for low light applications. Ignition switch: A three (3)-position maintained/momentary rocker switch will be provided. The first switch position will deactivate vehicle ignition. The second switch position will activate vehicle ignition. The third momentary position will disable the Command Zone audible alarm if held for three (3) to five (5) seconds. A green indicator lamp will be activated with vehicle ignition. Engine start switch: A two (2)-position momentary rocker switch will be provided. The first switch position is the default switch position. The second switch position will activate the vehicle's engine. The switch actuator is designed to prevent accidental activation. 4-way hazard switch: A two (2)-position maintained rocker switch will be provided. The first switch position will deactivate the 4-way hazard switch function. The second switch position will activate the 4-way hazard function. The switch actuator will be red and includes the international 4-way hazard symbol. Heater, defroster, and optional air conditioning control panel: A control panel with membrane switches will be provided to control heater/defroster temperature and heater, defroster, and air conditioning fan speeds. A green LED status bar will indicate the relative temperature and fan speed settings. Turn signal arm: A self-canceling turn signal with high beam headlight and windshield wiper/washer controls will be provided. The windshield wiper control will have high, low, and intermittent modes. Parking brake control: An air actuated push/pull park brake control valve will be provided. Chassis horn control: Activation of the chassis horn control will be provided through the center of the steering wheel. CUSTOM SWITCH PANELS The design of cab instrumentation will allow for emergency lighting and other switches to be placed within easy reach of the operator thus improving safety. There will be positions for up to four (4) switch panels in the overhead console on the driver's side, up to four (4) switch panels in the engine tunnel console facing the driver, up to four (4) switch panels in the overhead console on the officer's side and up to two (2) switch panels in the engine tunnel console facing the officer. All switches will have backlit labels for low light applications. DIAGNOSTIC PANEL A diagnostic panel will be accessible while standing on the ground and located inside the driver's side door left of the steering column. The diagnostic panel will allow diagnostic tools such as computers to connect to various vehicle systems for improved troubleshooting providing a lower cost of ownership. Diagnostic switches will allow ABS systems to provide blink codes should a problem exist. The diagnostic panel will include the following: - Engine diagnostic port - Transmission diagnostic port - ABS diagnostic port - SRS diagnostic port (where applicable) - Command Zone USB diagnostic port - ABS diagnostic switch (blink codes flashed on ABS telltale indicator) - Diesel particulate filter regeneration switch (where applicable) - Diesel particulate filter regeneration inhibit switch (where applicable) CAB LCD DISPLAY A digital four (4)-row by 20-character dot matrix display will be integral to the gauge panel. The display will be capable of showing simple graphical images as well as text. The display will be split into three (3) sections. Each section will have a dedicated function. The upper left section will display the outside ambient temperature. The upper right section will display, along with other configuration specific information: - Odometer - Trip mileage - PTO hours - Fuel consumption - Engine hours The bottom section will display INFO, CAUTION, and WARNING messages. Text messages will automatically activate to describe the cause of an audible caution or warning alarm. The LCD will be capable of displaying multiple text messages should more than one caution or warning condition exist. 0509511 Air Restriction Indicator, Imp/Vel, AXT, Dash CF, Enf MUX AIR RESTRICTION INDICATOR A high air restriction warning indicator light LCD message with amber warning indicator and audible alarm shall be provided. 0543751 Light, Do Not Move Apparatus "DO NOT MOVE APPARATUS" INDICATOR A flashing red indicator light, located in the driving compartment, will be illuminated automatically per the current NFPA requirements. The light will be labeled "Do Not Move Apparatus If Light Is On." The same circuit that activates the Do Not Move Apparatus indicator will activate a pulsing alarm when the parking brake is released. 22751Bid #: 0509042 Messages, Open Door/Do Not Move Truck, MUX w/Color Display DO NOT MOVE TRUCK MESSAGES Messages will be displayed on the Command Zone™, color display located within sight of the driver whenever the Do Not Move Truck light is active. The messages will designate the item or items not in the stowed for vehicle travel position (parking brake disengaged). The following messages will be displayed (where applicable): Do Not Move Truck DS Cab Door Open (Driver Side Cab Door Open) PS Cab Door Open (Passenger's Side Cab Door Open) DS Crew Cab Door Open (Driver Side Crew Cab Door Open) PS Crew Cab Door Open (Passenger's Side Crew Cab Door Open) DS Body Door Open (Driver Side Body Door Open) PS Body Door Open (Passenger's Side Body Door Open) Rear Body Door Open DS Ladder Rack Down (Driver Side Ladder Rack Down) PS Ladder Rack Down (Passenger Side Ladder Rack Down) Deck Gun Not Stowed Lt Tower Not Stowed (Light Tower Not Stowed) Fold Tank Not Stowed (Fold-A-Tank Not Stowed) Aerial Not Stowed (Aerial Device Not Stowed) Stabilizer Not Stowed Steps Not Stowed Handrail Not Stowed Any other device that is opened, extended, or deployed that creates a hazard or is likely to cause major damage to the apparatus if the apparatus is moved will be displayed as a caution message after the parking brake is disengaged. 0611681 Switching, Cab, Membrane, Impel/Velocity/Quantum, Dash CF, AXT WiFi MUX SWITCH PANELS The emergency light switch panel will have a master switch for ease of use plus individual switches for selective control. Each switch panel will contain eight (8) membrane-type switches each rated for one million (1,000,000) cycles. Panels containing less than eight (8) switch assignments will include non-functioning black appliqués. Documentation will be provided by the manufacturer indicating the rated cycle life of the switches. The switch panel(s) will be located in the overhead position above the windshield on the driver side overhead to allow for easy access. Additional switch panel(s) will be located in the overhead position(s) above the windshield or in designated locations on the lower instrument panel layout. The switches will be membrane-type and also act as an integral indicator light. For quick, visual indication the entire surface of the switch will be illuminated white whenever back lighting is activated and illuminated green whenever the switch is active. An active illuminated switch will flash when interlock requirements are not met or device is actively being load managed. For ease of use, a two (2)-ply, scratch resistant laser engraved Gravoply label indicating the use of each switch will be placed in the center of the switch. The label will allow light to pass through the letters for ease of use in low light conditions. 0555915 Wiper Control, 2-Speed with Intermittent, MUX, Impel/Velocity WIPER CONTROL For simple operation and easy reach, the windshield wiper control will be an integral part of the directional light lever located on the steering column. The wiper control will include high and low wiper speed settings, a one (1)-speed intermittent wiper control and windshield washer switch. The control will have a "return to park" provision, which allows the wipers to return to the stored position when the wipers are not in use. 0669028 Hourmeter, Aerial Inside Cab, Deadman Switch HOURMETER - AERIAL DEVICE An hour meter for the aerial device will be provided and located within the cab display or instrument panel. The hour meter will be activated only while the dead man switch is applied. 0002615 Switch, Aerial 12V Master AERIAL MASTER There will be a master switch for the aerial operating electrical system provided. 0002617 PTO switch, w/light - aerial AERIAL PTO SWITCH A PTO switch for the aerial with indicator light will be provided. 0548004 Wiring, Spare, 15 A 12V DC 1st SPARE CIRCUIT There will be four (4) pair of wires, including a positive and a negative, installed on the apparatus. The above wires will have the following features: The positive wire will be connected directly to the battery power The negative wire will be connected to ground Wires will be protected to 15 amps at 12 volts DC Power and ground will terminate behind officer seat, in EMS compartment(s) and in the center console Termination will be with heat shrinkable butt splicing Wires will be sized to 125 percent of the protection The circuit(s) may be load managed when the parking brake is set. 0615386 Vehicle Information Center, 7" Color Display, Touchscreen, MUX INFORMATION CENTER An information center employing a 7.00" diagonal touch screen color LCD display will be encased in an ABS plastic housing. The information center will have the following specifications: Operate in temperatures from -40 to 185 degrees Fahrenheit 23751Bid #: An Optical Gel will be placed between the LCD and protective lens Five weather resistant user interface switches Grey with black accents Sunlight Readable Linux operating system Minimum of 1000nits rated display Display can be changed to an available foreign language A LCD display integral to the cab gauge panel will be included as outlined in the cab instrumentation area. Programmed to read US Customary GENERAL SCREEN DESIGN Where possible, background colors will be used to provide "At a Glance" vehicle information. If information provided on a screen is within acceptable limits, a green background will be used. If a caution or warning situation arises the following will occur: An amber background/text color will indicate a caution condition A red background/text color will indicate a warning condition The information center will utilize an "Alert Center" to display text messages for audible alarm tones. The text messages will be written to identify the item(s) causing the audible alarm to sound. If more than one (1) text message occurs, the messages will cycle every second until the problem(s) have been resolved. The background color for the "Alert Center" will change to indicate the severity of the "warning" message. If a warning and a caution condition occur simultaneously, the red background color will be shown for all alert center messages. A label for each button will exist. The label will indicate the function for each active button for each screen. Buttons that are not utilized on specific screens will have a button label with no text or symbol. HOME/TRANSIT SCREEN This screen will display the following: Vehicle Mitigation (if equipped) Water Level (if the water level system includes compatible communications to the information center) Foam Level (if the foam level system includes compatible communications to the information center) Seat Belt Monitoring Screen Seat Belt Monitoring Screen Tire Pressure Monitoring (if equipped) Digital Speedometer Active Alarms ON SCENE SCREEN This screen will display the following and will be auto activated with pump engaged (if equipped): Battery Voltage Fuel Oil Pressure Coolant Temperature RPM Water Level (if equipped) Foam Level (if equipped) Foam Concentration (if equipped) Water Flow Rate (if equipped) Water Used (if equipped) Active Alarms VIRTUAL BUTTONS There will be four (4) virtual switch panel screens that match the overhead and lower lighting and HVAC switch panels. PAGE SCREEN The page screen will display the following and allow the user to progress into other screens for further functionality: Diagnostics Faults Listed by order of occurrence Allows to sort by system Interlock Throttle Interlocks Pump Interlocks (if equipped) Aerial Interlocks (if equipped) PTO Interlocks (if equipped) Load Manager A list of items to be load managed will be provided. The list will provide a description of the load. The lower the priority numbers the earlier the device will be shed should a low voltage condition occur. The screen will indicate if a load has been shed (disabled) or not shed. "At a glance" color features are utilized on this screen. Systems Command Zone Module type and ID number Module Version Input or output number Circuit number connected to that input or output Status of the input or output Power and Constant Current module diagnostic information Foam (if equipped) Pressure Controller (if equipped) Generator Frequency (if equipped) Live Data General Truck Data Maintenance Engine oil and filter Transmission oil and filter Pump oil (if equipped) Foam (if equipped) 24751Bid #: Aerial (if equipped) Setup Clock Setup Date & Time 12 or 24 hour format Set time and date Backlight Daytime Night time Sensitivity Unit Selection Home Screen Virtual Button Setup On Scene Screen Setup Configure Video Mode Set Video Contrast Set Video Color Set Video Tint Do Not Move The screen will indicate the approximate location and type of item that is open or is not stowed for travel. The actual status of the following devices will be indicate Driver Side Cab Door Passenger's Side Cab Door Driver Side Crew Cab Door Passenger's Side Crew Cab Door Driver Side Body Doors Passenger's Side Body Doors Rear Body Door(s) Ladder Rack (if applicable) Deck Gun (if applicable) Light Tower (if applicable) Hatch Door (if applicable) Stabilizers (if applicable) Steps (if applicable) Notifications View Active Alarms Shows a list of all active alarms including date and time of the occurrence is shown with each alarm Silence Alarms - All alarms are silenced Timer Screen HVAC (if equipped) Tire Information (if equipped) Ascendant Set Up Confirmation (if equipped) Button functions and button labels may change with each screen. 0606247 Vehicle Data Recorder w/CZ Display Seat Belt Monitor VEHICLE DATA RECORDER There will be a vehicle data recorder (VDR) capable of reading and storing vehicle information provided. The information stored on the VDR can be downloaded through a USB port mounted in a convenient location determined by cab model. A USB cable can be used to connect the VDR to a laptop to retrieve required information. The program to download the information from the VDR will be available to download on-line. The vehicle data recorder will be capable of recording the following data via hardwired and/or CAN inputs: Vehicle Speed - MPH Acceleration - MPH/sec Deceleration - MPH/sec Engine Speed - RPM Engine Throttle Position - % of Full Throttle ABS Event - On/Off Seat Occupied Status - Yes/No by Position Seat Belt Buckled Status - Yes/No by Position Master Optical Warning Device Switch - On/Off Time - 24 Hour Time Date - Year/Month/Day Seat Belt Monitoring System A seat belt monitoring system (SBMS) will be provided on the Command Zone™ color display. The SBMS will be capable of monitoring up to 10 seating positions indicating the status of each seat position per the following: Seat Occupied & Buckled = Green LED indicator illuminated Seat Occupied & Unbuckled = Red LED indicator with audible alarm No Occupant & Buckled = Red LED indicator with audible alarm No Occupant & Unbuckled = No indicator and no alarm The seat belt monitoring screen will become active on the Command Zone color display when: The home screen is active: and there is any occupant seated but not buckled or any belt buckled with an occupant. and there are no other Do Not Move Apparatus conditions present. As soon as all Do Not Move Apparatus conditions are cleared, the SBMS will be activated. The SBMS will include an audible alarm that will warn that an unbuckled occupant condition exists and the parking brake is released, or the transmission is not in park. 25751Bid #: 0791824 Intercom, Firecom 5100D Single Radio, 1 Wireless Base Station, (D,O,3C,Wired) INTERCOM SYSTEM There will be digital, single radio interface, intercom located in reach of the officer to match job 28686 in the cab. The front panel will have master volume, and squelch controls with illuminated indicators, allowing for independent level setting of radio and auxiliary audio devices. There will be one (1) radio listen only / transmit control with select, monitor, receive, and transmit indicators. There will be one (1) auxiliary audio input with select, and receive indicators. There will be one (1) wireless base station for up to five (1-5) headset users provided. Wired headset jacks will be provided for the driver, officer, and three (3) crew positions located at three (3) forward facing seats. The wireless base station will have a 100' to 1100' range, line of sight. Objects between the transmitter and receiver affect range. The following Firecom components will be provided: One (1) 5100D Intercom One (1) WB505R wireless base station (1-5 wireless positions) Five (5) HM-10 Interior headset jacks All necessary power and station cabling 0006240 Cable, Radio to Intercom Interface, Firecom, 1 Radio RADIO / INTERCOM INTERFACE CABLE The apparatus manufacturer will supply and install one (1) radio interface cable before delivery of the vehicle. The radio equipment to be used by the customer will be: Motorola High Power , Model number Motorola, Model APX 7500, high power. 0602376 Headset, Firecom, Wireless, UHW- 505 Under Helmet, Radio Transmit WIRELESS UNDER HELMET, RADIO TRANSMIT ONLY HEADSET There will be one (1) Firecom™, Model UHW-505, wireless under the helmet, radio transmit headset(s) provided. A heavy duty, coiled 12 volt charging pigtail with plug will be provided driver side EMS compartment. Each headset will feature: Noise cancelling electric microphone Flexible microphone boom Ear seals with 20 dB noise reduction Stereo Listen-Through Ear dome microphones Radio Push To Transmit button (Left or Right Side) Rechargeable battery operates for 24 hours on a full charge IP-66 when worn 0681384 Headset, Firecom, UH-52 Under Helmet, Intercom Only UNDER THE HELMET HEADSET, INTERCOM ONLY There will be three (3) Firecom™, Model UH-52, under helmet, intercom only headset(s) provided driver's side inboard forward facing seat, passenger's side inboard forward facing seat and passenger's side outboard forward facing seat. Each headset will feature: Coiled cord with rugged angled plug Noise cancelling electric microphone Flex boom for left or right dress Adjustable volume control ComLeather ear seals with 24 dB noise reduction Intercom Push To Talk button 0681389 Headset, Firecom, UH-51 Under Helmet, Radio Transmit UNDER THE HELMET HEADSET, RADIO TRANSMIT There will be two (2) Firecom™, Model UH-51, under helmet, radio transmit headset(s) provided driver's seat and officer seat. Each headset will feature: Coiled cord with rugged angled plug Noise cancelling electric microphone Flex boom rotates for left or right dress Adjustable volume control ComLeather ear seals with 24 dB noise reduction Radio Push To Transmit button. Mic is always live for intercom communication 0000000 STF Install Customer Provided Two-Way Radio(s) TWO WAY RADIO INSTALLATION There will be one (1) customer supplied two way radio(s) sent to the apparatus manufacturers preferred radio installer to be installed determined at service center per the shipping document. No antenna mount or whip will be included in this option. Specific radio shipping requirements will be followed. 0696439 Antenna Mount, Custom Chassis, Cable Routed to Instrument Panel Area RADIO ANTENNA MOUNT There will be one (1) standard 1.125", 18 thread antenna-mounting base(s) installed on the right side on the cab roof with high efficiency, low loss, coaxial cable(s) routed to the instrument panel area. A weatherproof cap will be installed on the mount. 26751Bid #: 0589496 Camera, Zone Defense, Driver Mux, Rear Camera Only REAR CAMERA VIDEO A color rear view video camera will be located at the rear of the vehicle as close to center as possible. Zone Defense, Model CAM-313C, camera features include: Waterproof and weather resistant, IP69 Built in microphone 18 infrared emitters for 0 lux operation 120 degree lens 1/3 CCD The camera will be activated with the reverse signal. Images will be displayed in the cab on the driver's vehicle information center display. Audio from the active camera will be via an amplified speaker with volume control located behind the driver seat. 0511071 Guard, 4-Way, Rear Vision Camera VEHICLE CAMERA GUARD There will be one (1) aluminum treadplate guard(s) fastened over the vehicle camera(s) located over camera centered . 0796440 Pierce Command Zone, Advanced Electronics & Control System, Velocity, Black WiFi ELECTRICAL POWER CONTROL SYSTEM The primary power distribution will be located forward of the officer's seating position and be easily accessible while standing on the ground for simplified maintenance and troubleshooting. Additional electrical distribution centers will be provided throughout the vehicle to house the vehicle's electrical power, circuit protection, and control components. The electrical distribution centers will be located strategically throughout the vehicle to minimize wire length. For ease of maintenance, all electrical distribution centers will be easily accessible. All distribution centers containing fuses, circuit breakers and/or relays will be easily accessible. Distribution centers located throughout the vehicle will contain battery powered studs for supplying customer installed equipment thus providing a lower cost of ownership. Circuit protection devices, which conform to SAE standards, will be utilized to protect electrical circuits. All circuit protection devices will be rated per NFPA requirements to prevent wire and component damage when subjected to extreme current overload. General protection circuit breakers will be Type-I automatic reset (continuously resetting). When required, automotive type fuses will be utilized to protect electronic equipment. Control relays and solenoid will have a direct current rating of 125 percent of the maximum current for which the circuit is protected per NFPA. SOLID-STATE CONTROL SYSTEM A solid-state electronics based control system will be utilized to achieve advanced operation and control of the vehicle components. A fully computerized vehicle network will consist of electronic modules located near their point of use to reduce harness lengths and improve reliability. The control system will comply with SAE J1939-11 recommended practices. The control system will operate as a master-slave system whereas the main control module instructs all other system components. The system will contain patented Mission Critical software that maintains critical vehicle operations in the unlikely event of a main controller error. The system will utilize a Real Time Operating System (RTOS) fully compliant with OSEK/VDX™ specifications providing a lower cost of ownership. For increased reliability and simplified use the control system modules will include the following attributes: Green LED indicator light for module power Red LED indicator light for network communication stability status Control system self test at activation and continually throughout vehicle operation No moving parts due to transistor logic Software logic control for NFPA mandated safety interlocks and indicators Integrated electrical system load management without additional components Integrated electrical load sequencing system without additional components Customized control software to the vehicle's configuration Factory and field re programmable to accommodate changes to the vehicle's operating parameters Complete operating and troubleshooting manuals USB connection to the main control module for advanced troubleshooting To assure long life and operation in a broad range of environmental conditions, the solid-state control system modules will meet the following specifications: Module circuit board will meet SAE J771 specifications Operating temperature from -40C to +70C Storage temperature from -40C to +70C Vibration to 50g IP67 rated enclosure (Totally protected against dust and also protected against the effect of temporary immersion between 15 centimeters and one (1) meter) Operating voltage from eight (8) volts to 16 volts DC The main controller will activate status indicators and audible alarms designed to provide warning of problems before they become critical. CIRCUIT PROTECTION AND CONTROL DIAGRAM Copies of all job-specific, computer network input and output (I/O) connections will be provided with each chassis. The sheets will indicate the function of each module connection point, circuit protection information (where applicable), wire numbers, wire colors and load management information. ON-BOARD ELECTRICAL SYSTEM DIAGNOSTICS Advanced on-board diagnostic messages will be provided to support rapid troubleshooting of the electrical power and control system. The diagnostic messages will be displayed on the information center located at the driver's position. The on-board information center will include the following diagnostic information: Text description of active warning or caution alarms Simplified warning indicators Amber caution indication with intermittent alarm Red warning indication with steady tone alarm TECH MODULE WITH WIFI An in cab module will provide WiFi wireless interface and data logging capability. The WiFi 27751Bid #: interface will comply with IEEE 802.11 b/g/n capabilities while communicating at 2.4 Gigahertz. The module will provide a black external antenna connection allowing a line of site communication range of up to 300 feet with a roof mounted antenna. The module will transmit a password protected web page to a WiFi enabled device (i.e. most smart phones, tablets or laptops) allowing two levels of user interaction. The firefighter level will allow vehicle monitoring of the vehicle and firefighting systems on the apparatus. The technician level will allow diagnostic access to inputs and outputs installed on the Command Zone™, control and information system. The data logging capability will record faults from the engine, transmission, ABS and Command Zone, control and information systems as they occur. No other data will be recorded at the time the fault occurs. The data logger will provide up to 2 Gigabytes of data storage. A USB connection will be provided on the Tech Module. It will provide a means to download data logger information and update software in the device. PROGNOSTICS A software based vehicle tool will be provided to predict remaining life of the vehicles critical fluid and events. The system will send automatic indications to the Command Zone, color display and/or wireless enabled device to proactively alert of upcoming service intervals. Prognostics will include: Engine oil and filter Transmission oil and filter Pump oil (if equipped) Foam oil (if equipped) Aerial oil and filter (if equipped) ADVANCED DIAGNOSTICS An advanced, Windows-based, diagnostic software program will be provided for this control system. The software will provide troubleshooting tools to service technicians equipped with a Windows-based computer or wireless enabled device. The service and maintenance software will be easy to understand and use and have the ability to view system input/output (I/O) information. INDICATOR LIGHT AND ALARM PROVE-OUT SYSTEM A system will be provided which automatically tests basic indicator lights and alarms located on the cab instrument panel. VOLTAGE MONITOR SYSTEM A voltage monitoring system will be provided to indicate the status of the battery system connected to the vehicle's electrical load. The system will provide visual and audible warning when the system voltage is below or above optimum levels. The alarm will activate if the system falls below 11.8 volts DC for more than two (2) minutes. DEDICATED RADIO EQUIPMENT CONNECTION POINTS There will be three (3) studs provided in the primary power distribution center located in front of the officer for two-way radio equipment. The studs will consist of the following: 12-volt 40-amp battery switched power 12-volt 60-amp ignition switched power 12-volt 60-amp direct battery power There will also be a 12-volt 100-amp ground stud located in or adjacent to the power distribution center. ENHANCED SOFTWARE The solid-state control system will include the following software enhancements: All perimeter lights and scene lights (where applicable) will be deactivated when the parking brake is released. Cab and crew cab dome lights will remain on for ten (10) seconds for improved visibility after the doors close. The dome lights will dim after ten (10) seconds or immediately if the vehicle is put into gear. Cab and crew cab perimeter lights will remain on for ten (10) seconds for improved visibility after the doors close. The dome lights will dim after ten (10) seconds or immediately if the vehicle is put into gear. EMI/RFI PROTECTION To prevent erroneous signals from crosstalk contamination and interference, the electrical system will meet, at a minimum, SAE J551/2, thus reducing undesired electromagnetic and radio frequency emissions. An advanced electrical system will be used to ensure radiated and conducted electromagnetic interference (EMI) or radio frequency interference (RFI) emissions are suppressed at their source. The apparatus will have the ability to operate in the electromagnetic environment typically found in fire ground operations to ensure clean operations. The electrical system will meet, without exceptions, electromagnetic susceptibility conforming to SAE J1113/25 Region 1, Class C EMR for 10Khz-1GHz to 100 Volts/Meter. The vehicle OEM, upon request, will provide EMC testing reports from testing conducted on an entire apparatus and will certify that the vehicle meets SAE J551/2 and SAE J1113/25 Region 1, Class C EMR for 10Khz-1GHz to 100 Volts/Meter requirements. EMI/RFI susceptibility will be controlled by applying appropriate circuit designs and shielding. The electrical system will be designed for full compatibility with low-level control signals and high- powered two-way radio communication systems. Harness and cable routing will be given careful attention to minimize the potential for conducting and radiated EMI/RFI susceptibility. 28751Bid #: 0624254 Electrical System, Velocity ELECTRICAL All 12-volt electrical equipment installed by the apparatus manufacturer will conform to modern automotive practices. All wiring will be high temperature crosslink type. Wiring will be run, in loom or conduit, where exposed and have grommets where wire passes through sheet metal. Automatic reset circuit breakers will be provided which conform to SAE Standards. Wiring will be color, function and number coded. Function and number codes will be continuously imprinted on all wiring harness conductors at 2.00" intervals. Exterior exposed wire connectors will be positive locking, and environmentally sealed to withstand elements such as temperature extremes, moisture and automotive fluids. Electrical wiring and equipment will be installed utilizing the following guidelines: All holes made in the roof will be caulked with silicon. Large fender washers, liberally caulked, will be used when fastening equipment to the underside of the cab roof. Any electrical component that is installed in an exposed area will be mounted in a manner that will not allow moisture to accumulate in it. Exposed area will be defined as any location outside of the cab or body. Electrical components designed to be removed for maintenance will not be fastened with nuts and bolts. Metal screws will be used in mounting these devices. Also a coil of wire will be provided behind the appliance to allow them to be pulled away from mounting area for inspection and service work. Corrosion preventative compound will be applied to all terminal plugs located outside of the cab or body. All non-waterproof connections will require this compound in the plug to prevent corrosion and for easy separation (of the plug). All lights that have their sockets in a weather exposed area will have corrosion preventative compound added to the socket terminal area. All electrical terminals in exposed areas will have silicon (1890) applied completely over the metal portion of the terminal. All lights and reflectors, required to comply with Federal Motor Vehicle Safety Standard #108, will be furnished. Rear identification lights will be recessed mounted for protection. Lights and wiring mounted in the rear bulkheads will be protected from damage by installing a false bulkhead inside the rear compartments. An operational test will be conducted to ensure that any equipment that is permanently attached to the electrical system is properly connected and in working order. The results of the tests will be recorded and provided to the purchaser at time of delivery. 0079211 Batteries, (6) Exide Grp 31, 950 CCA each, Threaded Stud BATTERY SYSTEM There will be six (6) 12 volt Exide®, Model 31S950X3W, batteries that include the following features will be provided: 950 CCA, cold cranking amps 190 amp reserve capacity High cycle Group 31 Rating of 5700 CCA at 0 degrees Fahrenheit -140 minutes of reserve capacity Threaded stainless steel studs Each battery case will be a black polypropylene material with a vertically ribbed container for increased vibration resistance. The cover will be manifold vented with a central venting location to allow a 45 degree tilt capacity. The inside of each battery will consist of a "maintenance free" grid construction with poly wrapped separators and a flooded epoxy bottom anchoring for maximum vibration resistance. 0008621 Battery System, Single Start, All Custom Chassis BATTERY SYSTEM There will be a single starting system with an ignition switch and starter button provided and located on the cab instrument panel. MASTER BATTERY SWITCH There will be a master battery switch provided within the cab within easy reach of the driver to activate the battery system. An indicator light will be provided on the instrument panel to notify the driver of the status of the battery system. 0123174 Battery Compartment, Imp/Vel BATTERY COMPARTMENTS The batteries will be stored in well-ventilated compartments that are located under the cab and bolted directly to the chassis frame. The battery compartments will be constructed of 3/16" steel plate and be designed to accommodate a maximum of three (3) group 31 batteries in each compartment. The compartments will include formed fit heavy-duty roto-molded polyethylene battery tray inserts with drains on each side of the frame rails. The batteries will be mounted inside of the roto-molded trays. JUMPER STUDS One (1) set of battery jumper studs with plastic color-coded covers will be installed on the battery box on the driver's side. This will allow enough room for easy jumper cable access. 29751Bid #: 0531338 Charger, Sngl Sys, Kussmaul, Pump Plus 1200, 52-21-1100 BATTERY CHARGER/ AIR COMPRESSOR There will be a Kussmaul™ Pump Plus 1200, Model # 52-21-1100, single output battery charger/air compressor system will be provided. A display bar graph indicating the state of charge will be included. The automatic charger will maintain one (1) set of batteries with a maximum output current of 40 amps. The 12-volt air compressor will be installed to maintain the air system pressure when the vehicle is not in use. There will be an auto pump timer installed between the pressure switch and the pump that will allow the pump to run for one hour than shut down for one hour. The battery charger will be wired to the AC shoreline inlet through an AC receptacle adjacent to this battery charger. 0598091 Location, Charger/Compr, Behind Driver's Seat, Vel/Imp/DCF Battery charger/compressor will be located behind the driver's seat. 0531403 Location, Bat Chrg Ind, Driver's Seat with Bracket The battery charger indicator will be located near the driver's seat riser with special bracketry. 0016857 Shoreline, 20A 120V, Kussmaul Auto Eject, 091-55-20-120, Super AUTO EJECT FOR SHORELINE There will be two (2) Kussmaul™, Model 091-55-20-120, 20 amp 120 volt AC shoreline inlet(s) provided to operate the dedicated 120 volt AC circuits on the apparatus. The shoreline inlet(s) will include red weatherproof flip up cover(s). There will be a release solenoid wired to the vehicle's starter to eject the AC connector when the engine is starting. The shoreline(s) will be connected to battery and other for dometic AC and cab receptacles. There will be a mating connector body supplied with the loose equipment. There will be a label installed near the inlet(s) that state the following: Line Voltage Current Ratting (amps) Phase Frequency 0026800 Shoreline Location The shoreline receptacle will be located on the driver side of cab, to the front of cab door. 0783395 Transfer Switch, Generator to Shoreline 30 Amp and Under GENERATOR TO SHORELINE TRANSFER SWITCH There will be an automatic transfer switch between the onboard generator and the shoreline inlet. The loads connected to the transfer switch will be power from the onboard generator when the generator is running. 0647728 Alternator, 430 amp, Delco Remy 55SI ALTERNATOR A Delco Remy®, Model 55SI, alternator will be provided. It will have a rated output current of 430 amps, as measured by SAE method J56. The alternator will feature an integral regulator and rectifier system that has been tested and qualified to an ambient temperature of 257 degrees Fahrenheit (125 degrees Celsius). The alternator will be connected to the power and ground distribution system with heavy-duty cables sized to carry the full rated alternator output. 30751Bid #: 0092582 Load Manager/Sequencer, MUX ELECTRONIC LOAD MANAGER An electronic load management (ELM) system will be provided that monitors the vehicles 12-volt electrical system, automatically reducing the electrical load in the event of a low voltage condition, and automatically restoring the shed electrical loads when a low voltage condition expires. This ensures the integrity of the electrical system. For improved reliability and ease of use, the load manager system will be an integral part of the vehicle's solid state control system requiring no additional components to perform load management tasks. Load management systems which require additional components will not be allowed. The system will include the following features: System voltage monitoring. A shed load will remain inactive for a minimum of five minutes to prevent the load from cycling on and off. Sixteen available electronic load shedding levels. Priority levels can be set for individual outputs. High Idle to activate before any electric loads are shed and deactivate with the service brake. If enabled: "Load Man Hi-Idle On" will display on the information center. Hi-Idle will not activate until 30 seconds after engine start up. Individual switch "on" indicator to flash when the particular load has been shed. The information center indicates system voltage. The information center, where applicable, includes a "Load Manager" screen indicating the following: Load managed items list, with priority levels and item condition. Individual load managed item condition: ON = not shed SHED = shed SEQUENCER A sequencer will be provided that automatically activates and deactivates vehicle loads in a preset sequence thereby protecting the alternator from power surges. This sequencer operation will allow a gradual increase or decrease in alternator output, rather than loading or dumping the entire 12 volt load to prolong the life of the alternator. For improved reliability and ease of use, the load sequencing system will be an integral part of the vehicle's solid state control system requiring no additional components to perform load sequencing tasks. Load sequencing systems which require additional components will not be allowed. Emergency light sequencing will operate in conjunction with the emergency master light switch. When the emergency master switch is activated, the emergency lights will be activated one by one at half-second intervals. Sequenced emergency light switch indicators will flash while waiting for activation. When the emergency master switch is deactivated, the sequencer will deactivate the warning light loads in the reverse order. Sequencing of the following items will also occur, in conjunction with the ignition switch, at half- second intervals: Cab Heater and Air Conditioning Crew Cab Heater (if applicable) Crew Cab Air Conditioning (if applicable) Exhaust Fans (if applicable) Third Evaporator (if applicable) 0783153 Headlights, Rect LED, JW Spkr Evo 2, AXT/DCF/Enf/Imp/Sab/Vel HEADLIGHTS There will be four (4) JW Speaker®, rectangular LED lights mounted in the front quad style, chrome housing on each side of the cab grille: the outside light on each side will contain a part number 055***1 low beam module the inside light on each side will contain a part number 055***1 high beam module the headlight to include chrome bezels The low beam lights will be activated when the headlight switch is on. The high beam and low beam lights will be activated when the headlight switch and the high beam switch is activated. 0648425 Light, Directional, Wln 600 Cmb, Cab Crn, Imp/Vel/AXT/Qtm/DCF DIRECTIONAL LIGHTS There will be two (2) Whelen 600® series, LED combination directional/marker lights provided. The lights will be located on the outside cab corners, next to the headlights. The color of the lenses will be the same color as the LED's. 0620054 Light, Directional/Marker, Intermediate, Weldon 9186-8580-29 LED 2lts INTERMEDIATE LIGHT There will be two (2) Weldon, Model 9186-8580-29, amber LED turn signal marker lights furnished, one (1) each side, in the rear fender panel. The light will double as a turn signal and marker light. 0648074 Lights, Clearance/Marker/ID, Front, P25 LED 7 Lts CAB CLEARANCE/MARKER/ID LIGHTS There will be seven (7) amber LED lights provided to indicate the presence and overall width of the vehicle in the following locations: Three (3) amber LED identification lights will be installed in the center of the cab above the windshield. Two (2) amber LED clearance lights will be installed, one (1) on each outboard side of the cab above the windshield. Two (2) amber LED marker lights will be installed, one (1) on each side above the cab doors. 31751Bid #: 0511569 Lights, Clearance/Marker/ID, Rear, P25 LED 7Lts REAR CLEARANCE/MARKER/ID LIGHTING There will be three (3) LED identification lights located at the rear installed per the following: As close as practical to the vertical centerline Centers spaced not less than 6.00" or more than 12.00" apart Red in color All at the same height There will be two (2) LED lights installed at the rear of the apparatus used as clearance lights located at the rear of the apparatus per the following: To indicate the overall width of the vehicle One (1) each side of the vertical centerline As near the top as practical Red in color To be visible from the rear All at the same height There will be two (2) LED lights installed on the side of the apparatus used as marker lights as close to the rear as practical per the following: To indicate the overall length of the vehicle One (1) each side of the vertical centerline As near the top as practical Red in color To be visible from the side All at the same height The lights will be mounted with no guard. There will be two (2) red reflectors located on the rear of the truck facing to the rear. One (1) each side, as far to the outside as practical, at a minimum of 15.00", but no more than 60.00", above the ground. There will be two (2) red reflectors located on the side of the truck facing to the side. One (1) each side, as far to the rear as practical, at a minimum of 15.00", but no more than 60.00", above the ground. Per FMVSS 108 and CMVSS 108 requirements. 0602938 Light, Marker End Outline, Rubber Arm, LED Marker Lamp, Rear Body MARKER LIGHTS There will be one (1) pair of amber and red LED marker lights with rubber arm, located at the rear most lower corner of the body. The amber lens will face the front and the red lens will face the rear of the truck. These lights will be activated with the running lights of the vehicle. 0564683 Lights, Tail, Wln M6BTT* Red LED Stop/Tail & M6T* Amber LED Dir Arw For Hsg REAR FMVSS LIGHTING The rear stop/tail and directional LED lighting will consist of the following: Two (2) Whelen®, Model M6BTT, red LED stop/tail lights Two (2) Whelen, Model M6T, amber LED arrow turn lights The lights shall be provided with color lenses. The lights will be mounted in a polished combination housing. 0561471 Lights, Backup, Wln M6BUW, LED, For Tail Lt Housing There will be two (2) Whelen Model M6BUW, LED backup lights provided in the tail light housing. 0664481 Bracket, License Plate & Light, P25 LED LICENSE PLATE BRACKET There will be one (1) license plate bracket mounted on the rear of the body. A white LED light will illuminate the license plate. A polished stainless steel light shield will be provided over the light that will direct illumination downward, preventing white light to the rear. 0556842 Bezels, Wln, (2) M6 Chrome Pierce, For mtg (4) Wln M6 lights LIGHTING BEZEL There will be two (2) Whelen, Model M6FCV4P, four (4) place chromed ABS housings with Pierce logos provided for the rear M6 series stop/tail, directional, back up, scene lights or warning lights. 0589905 Alarm, Back-up Warning, PRECO 1040 BACK-UP ALARM A PRECO, Model 1040, solid-state electronic audible back-up alarm that actuates when the truck is shifted into reverse will be provided. The device will sound at 60 pulses per minute and automatically adjust its volume to maintain a minimum ten (10) dBA above surrounding environmental noise levels. 0769569 Lights, Perimeter Cab, Amdor AY-LB- 12HW012 LED 4Dr CAB PERIMETER SCENE LIGHTS There will be four (4) Amdor, Model AY-LB-12HW012, 190 lumens each, 12.00" white LED strip lights provided. One (1) under the driver's side cab access step. One (1) under the passenger's side cab access step. One (1) under the passenger's side crew cab access step. One (1) under the driver's side crew cab access step. The lights will be activated when the battery switch is on and the respective door is open and whenever control has been selected for the body perimeter lights. 32751Bid #: 0769553 Lights, Perimeter Pump House, Amdor AY-LB-12HW012 LED 1lt PUMP HOUSE PERIMETER LIGHTS There will be one (1) Amdor, Model AY-LB-12HW012, 190 lumens each, 12.00" LED weatherproof strip lights with brackets provided under the passenger's side pump panel running boards. The light shall be activated when the battery switch is on, and controlled by the same means as the body perimeter lights. 0768498 Lights, Perimeter Body, Amdor AY- LB-12HW020 LED 1lt, Turntable Access BODY PERIMETER SCENE LIGHTS There will be one (1) Amdor®, Model AY-LB-12HW020, 20.00" 12 volt DC LED strip light provided under the side turntable access steps. The perimeter scene lights will be activated when the parking brake is applied. 0554198 Lights, Step, P25 LED, Aerial With Pump 2Lts, Pump Pnl Sw STEP LIGHTS Two (2) white LED step lights will be provided, one (1) on each side of the front body. In order to ensure exceptional illumination, each light shall provide a minimum of 25 foot-candles (fc) covering an entire 15" x 15" square placed ten (10) inches below the light and a minimum of 1.5 fc covering an entire 30" x 30" square at the same ten (10) inch distance below the light. The lights will be actuated with the pump panel light switch. All other steps on the apparatus will be illuminated per the current edition of NFPA 1901. 0629191 Light, FRC, 12V SPA260-Q20* LED MAX, Surface Mount 2nd 12 VOLT LIGHTING There will be one (1) Fire Research Spectra Max, Model SPA260-Q20, 12 volt LED surface mounted scene light(s) with white bezel(s) provided PS crew cab. The light(s) will be controlled in the following way: a switch at the driver's side switch panel a switch at the passenger's side switch panel no additional switch location no additional switch location The light(s) may be load managed when the parking brake is applied. 0629192 Light, FRC, 12V SPA260-Q20* LED MAX, Surface Mount 1st 12 VOLT LIGHTING There will be one (1) Fire Research Spectra Max, Model SPA260-Q20, 12 volt LED surface mounted scene light(s) with white bezel(s) provided DS crew cab . The light(s) will be controlled in the following way: a switch at the driver's side switch panel a switch at the passenger's side switch panel no additional switch location no additional switch location The light(s) may be load managed when the parking brake is applied. 0629418 Light, FRC, 12V SPA570-Q28* LED MAX, Fixed Top Mount 2nd 12 VOLT LIGHTING There will be one (1) Fire Research Spectra Max, Model SPA570-Q28, 12 volt DC LED floodlight (s) with a fixed top mount pedestals provided and located, at the transition from body to turntable compartments DS. The painted parts of this light assembly to be white with a white bezel. The light(s) will be controlled in the following way: from the driver's side cab scene light option control no additional switch location no additional switch location no additional switch location These lights may be load managed when the parking brake is applied. 0629421 Light, FRC, 12V SPA570-Q28* LED MAX, Fixed Top Mount 1st 12 VOLT LIGHTING There will be one (1) Fire Research Spectra Max, Model SPA570-Q28, 12 volt DC LED floodlight (s) with a fixed top mount pedestals provided and located, at the transition from body to turntable compartments PS. The painted parts of this light assembly to be white with a white bezel. The light(s) will be controlled in the following way: from the passenger's side cab scene light option control no additional switch location no additional switch location no additional switch location These lights may be load managed when the parking brake is applied. 0618301 Light, Visor, FRC, 12V SPA851-Q15- *, LED 1st 12 VOLT LIGHTING There will be two (2) Fire Research, Model SPA851-Q15-*, 12 volt LED floodlight(s) provided on the front visor, one (1) on the driver's side and one (1) on the passenger's side with 15 degree outward bracket. The painted parts of this light assembly to be black with a chrome bezel. The light(s) will be controlled in the following way: a switch at the driver's side switch panel a switch at the passenger's side switch panel no additional switch location These lights may be load managed when the parking brake is applied. 33751Bid #: 0657535 Lights, Work, (2) Wln PELCC LED, w/Alternative Hose Bed Lights REAR WORK LIGHTS There will be one (1) pair of Whelen, Model PELCC, white 12 volt DC LED scene lights installed at the rear of the body to the outside of the rear compartment. The lights will be directed down ward by a 40 degree angle and mounted with a chrome flange. The lights will be controlled by a control from a switch at the rear of the truck and a switch located at the driver side switch panel. 0645877 Lights, Hose Bed, Sides, Dual LED Light Strips HOSE BED LIGHTS There will be white 12 volt DC LED light strips with stainless steel protective cover, provided to light the hose bed area. Hose Bed lights will meet the photometric levels listed in NFPA 1901 for Hose Bed lighting requirements. Light strip(s) will be installed along the upper edge of the left side of the hose bed. Light strip(s) will be installed along the upper edge of the right side of the hose bed. The lights will be activated by a cup switch at the rear of the apparatus no more than 62.00" from the ground. 0645677 Lights, Not Required, Rear Work, Alt. 12 Volt Lights At Rear Body 0709438 Light, Walking Surf, FRP Flood, LED WALKING SURFACE LIGHT There will be Model FRP, 4" round black 12 volt DC LED floodlight with bolt mount provided to illuminate the entire designated walking surface on top of the body. The light will be activated when the body step lights are on. 0624713 Aerial, HD Ladder 107' ASL Single, Quint, Alum Body 0554271 Body Skirt Height, 20" 0601008 Tank, Water, 500 Gallon, Poly, Ascendant Single Axle WATER TANK The water tank will have a capacity of 500 gallons and will be constructed of polypropylene plastic in a rectangular shape. The joints and seams will be nitrogen welded inside and out. The tank will be baffled in accordance with current NFPA 1901 requirements. The baffles will have vent openings at both the top and bottom of each baffle to permit movement of air and water between compartments. The longitudinal partitions will be constructed of 0.38" polypropylene plastic and extend from the bottom of the tank through the top cover to allow positive welding. The transverse partitions extend from 4.00" off the bottom to the underside of the top cover. All partitions interlock and will be welded to the tank bottom and sides. The tank top will be constructed of 0.50" polypropylene. It will be recessed 0.38" and will be welded to the tank sides and the longitudinal partitions. It will be supported to keep it rigid during fast filling conditions. Construction will include 2.00" polypropylene dowels spaced no more than 30.00" apart and welded to the transverse partitions. Two of the dowels will be drilled and tapped (0.50" diameter, 13.00" deep) to accommodate lifting eyes. A sump will be provided at the bottom of the water tank. The sump will include a drain plug and the tank outlet. Tank will be installed in a fabricated "cradle" assembly constructed of structural steel. Sufficient crossmembers are provided to properly support bottom of tank. Crossmembers are constructed of steel bar channel or rectangular tubing. Tank "floats" in cradle to avoid torsional stress caused by chassis frame flexing. Rubber cushions, 0.50" thick x 3.00" wide, will be placed on all horizontal surfaces that the tank rests on. Stops are provided to prevent an empty tank from bouncing excessively while moving vehicle. Tank mounting system is approved by the manufacturer. 0003405 Overflow, 4.00" Water Tank, Poly Fill tower will be constructed of .50" polypropylene and will be a minimum of 8.00" wide x 14.00" long. Fill tower will be furnished with a .25" thick polypropylene screen and a hinged cover. An overflow pipe, constructed of 4.00" schedule 40 polypropylene, will be installed approximately halfway down the fill tower and extend through the water tank and exit to the rear of the rear axle. 0028104 Foam Cell Required 0003429 Not Required, Direct Tank Fill 34751Bid #: 0624711 Hose Bed, Alum, LS/RS, Ascendant Single Axle HOSE BED The hose bed will be fabricated of 0.125" 5052-H32 aluminum with a tensile strength range of 31,000 to 38,000 psi. The sides of the hose bed will not form any portion of the fender compartments. The upper and rear edges of the hose bed side panels will have a double break for rigidity. The hose bed will be located ahead of the ladder turntable. There will be a hose chute to the side and rear of the hose bed on both the left and right side to allow for payout/removal of the hose. The hose bed flooring will consist of removable aluminum grating with a top surface that is perforated to aid in hose aeration. 0003492 Hose Bed Capacity, Special Amount, Ascendant, PAP, PAL Hose capacity will be a minimum of 600' of 5" PS and 400' of 2.5" on DS. 0578797 Divider, Fixed, In Hose Bed, Left Side, 75' HAL, Ascendant Single Axle FIXED DIVIDER IN HOSE BED A fixed divider will be provided in the hose bed. The divider will run from the front of the water tank grating to the rear on the left side of the water tank. This divider will be gusseted to the tank grating at the front and rear for strength. 0604069 Hose Restraint, Two (2) Hose Beds, Aerial, Front Strap, 1" Heavy Nylon Web Rear AERIAL HOSE BED HOSE RESTRAINT The hose in the hose beds will be restrained by black nylon Velcro® straps at the top of the hose bed and 1.00" black nylon web design with a 2.00" box pattern at the rear of the hose beds. The Velcro strap will be installed to the top of the hose bed side sheets. The rear webbing will have 1.00" web straps that loop through footman loops and fasten with spring clip and hook fasteners. 0003512 Running Boards, Ascendant, PAL RUNNING BOARDS The running boards will be fabricated of 0.125" bright aluminum treadplate and supported by structural steel angle assemblies bolted to the chassis frame rails. Running boards will be 13.00" deep and are spaced away from the body 0.50". A splash guard will be provided to keep road dirt or water from splashing up onto the pump panels. The running boards will have a riser on the body to protect the painted surface from damage by stepping on the running boards. The entire surface of the running boards will be covered with bright aluminum treadplate. 0601894 Turntable Steps-Morton Cass, Swing- Down, LS Only, Non-TCO, Ascendant SA TURNTABLE STEPS Access to the turntable will be provided by a set of swing-down steps on the left side of the truck. The access steps will be located rearward of the compartmentation. All steps will have a height no greater than 14.00" from top surface to top surface. The swing down step mechanism will be constructed of brushed aluminum with bright aluminum steps with Morton Cass inserts. The stepwell will be lined with bright aluminum treadplate to act as scuffplates. A handrail will be provided on each side of the access steps. Holes will be provided in each side step plate for hand holds. The bottom step will have a step height not exceeding 24.00" from the ground to the top surface of the step at any time. The steps will be connected to the "Do Not Move Truck" indicator in the cab. 0554001 Lights, Step (3), P25 LED, Swing Down Access Steps, One Side STEP LIGHTS There will be three (3) white LED step lights provided for the aerial turntable access steps. In order to ensure exceptional illumination, each light shall provide a minimum of 25 foot-candles (fc) covering an entire 15" x 15" square placed ten (10) inches below the light and a minimum of 1.5 fc covering an entire 30" x 30" square at the same ten (10) inch distance below the light. The step lights will be actuated by the aerial master switch in the cab. 0690023 Wall, Rear, Smooth Aluminum SMOOTH ALUMINUM REAR WALL The rear wall will be smooth aluminum. 0074515 Tow Eyes (2), Ascendant 100' Aerial Tower, Ascendant Single Axle, 75' HAL TOW EYES Two (2) rear painted tow eyes will be located at the rear of the apparatus and will be mounted directly to the frame rails. The inner and outer edges of the tow eyes will be radiused. 35751Bid #: 0624701 Construction, Compt, Alum, 3rd Gen, Ascendant Single Axle COMPARTMENTATION Compartmentation will be fabricated of 0.125" 5052 aluminum. Side compartments will be an integral assembly with the rear fenders. Circular fender liners will be provided. For prevention of rust pockets and ease of maintenance, the fender liners will be formed from aluminum and removable for maintenance. Compartment flooring will be of the sweep out design with the floor higher than the compartment door lip. Drip protection will be provided above the doors by means of bright aluminum extrusion, formed bright aluminum treadplate or polished stainless steel. The top of the compartment will be covered with bright aluminum treadplate rolled over the edges on the front, rear and outward side. These covers will have the corners welded. Side compartment covers will be separate from the compartment tops. All screws and bolts, which are not Grade 8, will be stainless steel and where they protrude into a compartment will have acorn nuts on the ends to prevent injury. UNDERBODY SUPPORT SYSTEM The backbone of the body support system will begin with the aerial torque box which is the strongest component of the apparatus and is designed for sustaining maximum loads. An aluminum body structure will be mounted to the aerial torque box at three (3) points to create a floating substructure which will result in an 800 lb equipment support rating per lower compartment and provide up to 0.31" accumulative floor thickness. The three (3) point body mounting system will consist of two (2) points in the front and one (1) in the rear. The front mounts will attach to the top of the stabilizer H-box, and the rear mount will attach to the rear of the torque box at the chassis centerline. The body structure will be mounted with neoprene elastomer isolators. These isolators will have a broad load range, proven viability in vehicular applications, be of a fail-safe design and allow for all necessary movement in three (3) transitional and rotational modes. The combination of the three (3) point mounting system and elastomer isolators allow the chassis and torque box to flex without driving loads into the body. AGGRESSIVE WALKING SURFACE All exterior surfaces designated as stepping, standing, and walking areas will comply with the required average slip resistance of the current NFPA standards. LOUVERS All body compartments will be vented to provide one (1) way airflow out of the compartment that prevents water and dirt from gaining access to the compartment. TESTING OF BODY DESIGN Body structural analysis will be fully tested. Proven engineering and test techniques such as finite element analysis, model analysis, and strain gauging have been performed with special attention given to fatigue, life and structural integrity of the body and substructure. The body will be tested while loaded to its greatest in-service weight. The criteria used during the testing procedure will include: - Raising opposite corners of the vehicle tires 9.00" to simulate the twisting a truck may experience when driving over a curb. - Making a 90 degree turn, while driving at 20 mph to simulate aggressive driving conditions. - Driving the vehicle on at 35 mph on a washboard road. - Driving the vehicle at 55 mph on a smooth road. - Accelerating the vehicle fully, until reaching the approximate speed of 45 mph on rough pavement. Evidence of the actual testing techniques will be made available upon request. 0610141 Compt, LS F/H, Lap Drs, Ascendant Single Axle LEFT SIDE COMPARTMENTATION The full height double lap door compartment ahead of the rear wheels will be 39.19" wide x 63.00" high x 26.00" deep inside the lower 25.50" and 12.00" deep inside the upper portion with a clear door opening of 36.44" wide x 56.00" high. There will be one (1) lift-up door compartment above the wheelwell and stabilizer. The compartment will be 83.88" wide x 25.25" high x 12.00" deep inside with a clear door opening of 81.12" wide x 22.25" high. 0614991 Compt, LS Turntable, F/H, Lap Dr, Ascendant Single Axle The full height double door compartment behind the rear wheel will be 45.12" wide x 57.00" high x 26.00" deep inside the lower 25.50" and 12.00" deep in the upper portion with a clear door opening of 43.38" wide x 50.00" high. 0023672 Compt, IPO Stairs, Not Required, LS 0610140 Compt, RS F/H, Lap Drs, Ascendant Single Axle RIGHT SIDE COMPARTMENTATION The full height double lap door compartment ahead of the rear wheels will be 39.19" wide x 63.00" high x 26.00" deep inside the lower 25.50" and 12.00" deep inside the upper portion with a clear door opening of 36.44" wide x 56.00" high. There will be one (1) lift-up door compartment above the wheelwell and stabilizer. The compartment will be 83.88" wide x 25.25" high x 12.00" deep inside with a clear door opening of 81.12" wide x 22.25" high. 0614988 Compt, RS Turntable, F/H, Lap Dr, Ascendant Single Axle The full height double door compartment behind the rear wheel will be 45.12" wide x 57.00" high x 26.00" deep inside the lower 25.50" and 12.00" deep in the upper portion with a clear door opening of 43.38" wide x 50.00" high. 36751Bid #: 0607982 Compt, IPO Stairs RS, Lap Door, Ascendant Single Axle RIGHT SIDE COMPARTMENT IN PLACE OF TURNTABLE STEPS There will be a single door compartment in place of turntable stairs that is 20.88" wide x 57.00" high x 13.50" deep inside with a clear door opening of 19.12" wide x 50.00" high. 0615264 Compt, Rear, Gortite Rollup Door, Narrow, Ascendant Single Axle REAR COMPARTMENT A compartment will be provided at the rear of the unit. Compartment will be 27.75" wide x 35.00" high x 26.25" deep with a clear door opening of 25.00" wide x 29.50" high. The compartment will be furnished with a satin finish roll-up door. 0666824 Doors, Lap w/"D" Handle, Aluminum, Side Compartments SIDE COMPARTMENT DOORS All hinged compartment doors will be lap style with double panel construction and fabricated of .09" 5052H32 aluminum. Doors will be a minimum of 1.50" thick. To provide additional door strength, a "C" section reinforcement will be installed between the outer and interior panels. Doors will be provided with a closed cell rubber gasket around the surface that laps onto the body. A second heavy-duty automotive rubber molding with a hollow core will be installed on the door framing that seals onto the interior panel, to ensure a weather resisting compartment. All compartment doors will have polished stainless steel continuous hinge with a pin diameter of .25", that is bolted or screwed on with stainless steel fasteners. A dielectric substance will be applied to each hinge fastener. All door lock mechanisms will be fully enclosed within the door panels to prevent fouling of the lock in the event equipment inside shifts into the lock area. Doors will be latched with recessed, polished stainless steel "D" ring handles and Eberhard 106 locks. To prevent corrosion caused by dissimilar metals, compartment door handles will not be attached to outer door panel with screws. A rubber gasket will be provided between the "D" ring handle and the door. 0624690 Bumper, Rear, Aluminum Rub Rail, Ascendant Single Axle REAR BUMPER An aluminum rub rail will be provided at the rear of the unit. It will extend the full width of the body. 0603083 Lights, Compt,Pierce LED,Dual Light Strips,Each Side Dr,Ascend TA,75'HAL,PAP,HDL COMPARTMENT LIGHTING There will be nine (9) compartment(s) with two (2) white 12 volt DC LED compartment light strips. The dual light strips will be centered vertically along each side of the door framing. There will be two (2) light strips per compartment. The dual light strips will be in all body compartment(s). Any remaining compartments without light strips will have a 6.00" diameter Truck-Lite, Model: 79384 light. Each light will have a number 1076 one filament, two wire bulb. Opening the compartment door will automatically turn the compartment lighting on. 0687145 Shelf Tracks, Recessed, PUC/3rd Generation MOUNTING TRACKS There will be recessed tracks installed vertically to support the adjustable shelf(s). Tracks will not protrude into any compartment in order to provide the greatest compartment space and widest shelves possible. The tracks will be provided in each compartment except for the one that contains the pump operator's panel. 0600289 Shelves, Adj, 500 lb Capacity, Full Width/Depth, Predefined Locations, Aerial ADJUSTABLE SHELVES There will be ten (10) shelves with a capacity of 500 lb provided. The shelf construction will consist of .188" aluminum painted spatter gray with 2.00" sides. Each shelf will be infinitely adjustable by means of a threaded fastener, which slides in a track. The shelves will be held in place by .12" thick stamped plated brackets and bolts. The location(s) will be determined at a later date. 0603179 Tray, Floor Mounted, Slide-Out, 500lb, 2.00" Sides, 3G, Ascendant Single Axle SLIDE-OUT FLOOR MOUNTED TRAY There will be four (4) floor mounted slide-out tray(s) provided. Each tray will have 2.00" high sides and a minimum capacity rating of 500 lb in the extended position. Each tray will be constructed of aluminum painted spatter gray There will be two undermount-roller bearing type slides rated at 250lb each provided. The pair of slides will have a safety factor rating of 2. To ensure years of dependable service, the slides will be coated with a finish that is tested to withstand a minimum of 1,000 hours of salt spray per ASTM B117. To ensure years of easy operation, the slides will require no more than a 50lb force for push-in or pull-out movement when fully loaded after having been subjected to a 40 hour vibration (shaker) test under full load. The vibration drive file will have been generated from accelerometer data collected from a heavy truck chassis driven over rough gravel roads in an unloaded condition. Proof of compliance will be provided upon request. Automatic locks will be provided for both the "in" and "out" positions. The trip mechanism for the locks will be located at the front of the tray for ease of use with a gloved hand. The location(s) will be RS1, RS3, LS1 and LS3. 37751Bid #: 0650435 Toolboard, Swing-Out, Alum, .188", No Holes, 3G SWING OUT TOOLBOARD A swing out aluminum toolboard will be provided. It will be a minimum of .188" thick with a 1.00" x 1.00" aluminum tube frame welded around the edge. The board will be mounted on a pivoting device at the front of the compartment on the top and bottom to allow easy movement in and out of the compartment. The maximum tool load will be 400 pounds. The board will have positive lock in the stowed and extended position. The board will be mounted on adjustable tracks from front to back within the compartment. There will be One (1) toolboard(s) provided. The toolboard(s) will be spatter gray painted and installed LS2 over wheel. 0061917 Rub Rail, Aluminum Extruded, 3.12", Side of Body RUB RAIL Bottom edge of the side compartments will be trimmed with a bright aluminum extruded rub rail. Trim will be 3.12" high with 1.50" flanges turned outward for rigidity. The rub rails will not be an integral part of the body construction, which allows replacement in the event of damage. 0565606 Fender Crowns, Rear, S/S, w/Removable Fender Liner, Aerial, 3rd Gen BODY FENDER CROWNS Polished stainless steel fender crowns will be provided around the rear wheel openings. An unpainted fender liner will be provided to avoid paint chipping. The liners will be removable to aid in the maintenance of rear suspension components. A dielectric barrier will be provided between the fender crown fasteners (screws) and the fender sheet metal to prevent corrosion. The fender crowns will be held in place with stainless steel screws that thread directly into a composite nut and not directly into the parent body sheet metal to eliminate dissimilar metals contact and greatly reduce the chance for corrosion. 0519849 Not Required, Hose, Hard Suction HARD SUCTION HOSE Hard suction hose will not be required. 0626229 Handrails, Side Pump Panels, Per Print HANDRAILS The handrails will be 1.25" diameter anodized aluminum extrusion, with a ribbed design, to provide a positive gripping surface. Chrome plated end stanchions will support the handrail. Plastic gaskets will be used between end stanchions and any painted surfaces. Drain holes will be provided in the bottom of all vertically mounted handrails. Handrails will be provided to meet NFPA 1901 section 15.8 requirements. The handrails will be installed as noted on the sales drawing. 0074030 Compt, Air Bottle, Dbl, in Fender Panel, Alum, 3rd Gen. AIR BOTTLE STORAGE A total of three (3) air bottle compartments will be provided and located on the left side ahead of the rear wheel, on the right side ahead of the rear wheel and on the right side behind the rear wheel. The air bottle compartment will be a minimum of 15.00" wide x 7.50" tall x 26.00" deep. A polished stainless steel door with a chrome plated flush lift & turn latch will be provided to contain the air bottle. A dielectric barrier will be provided between the door hinge, hinge fasteners and the body sheet metal. Inside the compartment, black rubber matting will be provided. 0004225 Ladder, 24' Duo-Safety 900A 2- Section EXTENSION LADDER There will be a 24' two-section aluminum Duo-Safety Series 900-A extension ladder provided. 0084222 Extension Ladder, Not Required 0595251 Ladder, 16' Duo-Safety 875-DR Roof, Hooks Both Ends ROOF LADDER There will be one (1) 16' aluminum, Duo-Safety, Series 875-DR roof ladder(s) provided. The ladder(s) will have hooks on both ends. 0542436 Ladder, 16' Duo-Safety 875-DR Roof ADDED ROOF LADDER There will be one (1) 16' roof, aluminum, Series 875-A-DR provided. 0024233 Not Required, Attic Extension Ladder 0600819 Ladder, 10' Duo-Safety Folding, 585A, Ascendant Single Axle, 75' HAL AERIAL FOLDING LADDER There will be one (1) 10' aluminum Duo-Safety Series 585-A folding ladder(s) provided and located in the ladder storage compartment. 38751Bid #: 0624687 Ladders Stored at Rear, Ascendant Single Axle, Smooth Aluminum Doors GROUND LADDER STORAGE Ladder tunnels will be provided at the rear of the apparatus on either side of the turntable. Tunnels will be capable of holding up to two (2) two-section pumper style ladders on each side not in excess of 22.00" wide or 5-13/16" in thickness. The ladders will be held captive top and bottom by stainless steel tracks. A polyethylene wear plate will be provided to prevent ladders from being scuffed by contacting metal parts. The plate will be mounted to the bottom of the entrance area of the ladder tunnels. All ladders will be removable individually without having to remove any other ladder. A Velcro® strap will be provided to help contain the ladders. A smooth aluminum door will be provided on each ladder tunnel. 0600674 Lights, Torque Box Ladder Storage, Not Required, Ascendant Single, 75' HAL 0653539 Ladder, Little Giant, Revolution XE - Model 22, 12022 ADDITIONAL FOLDING LADDER One (1) Revolution XE Model 12022 Little Giant folding ladder will be provided. The stored dimensions will be 67.00" high x 26.50" wide x 9.25" deep. The weight will be 38lb. The ladder will be located in the ladder storage area where fits best. 0640426 SP Tray, Poly, Additional Hose Storage In Torque Box HOSE STORAGE Provisions will be made for a poly tray inside the torque box. The tray will be sized to hold 100' of 1.75" hose no more than 7' 6" long in total length for the bundle as a high rise pack hose. Three (3) hand holds will be provided on each side. There will be 0.75" drain holes provided in the bottom of the tray. The forward end of the tray will be closed off with a poly end cap. The rearward end of the tray will remain open. Structure will be provided in the torque box to support the tray and to allow it to be slide in or out similar to a speedlay. 0008911 Pike Pole, 12' Fire Hooks Unlimited, Fiberglass, APH-12, Gas Shut Off PIKE POLES There will be one (1) Fire Hooks Unlimited, Model APH-12, 12' pike pole(s) with fiberglass handles provided. The pike pole(s) will be located ladder storage area. 0009048 Pike Pole, 8' Fire Hooks Unlimited, Fiberglass, APH-8', Gas Shut Off 8' PIKE POLE There will be one (1) Fire Hooks Unlimited APH-8, 8' pike pole(s) with fiberglass handles and gas shut off end provided ladder storage area. 0552649 Pike Pole, 6' Fire Hooks Unlimited, New York Roof Hook, Steel, Pry End, RH-6 6 FT PIKE POLE There will be two (2) Fire Hooks Unlimited NY roof hook RH-6, 6 foot pike pole(s) with steel handles and pry end provided one each side rear of cab. 0638907 Pike Pole, 3', Quint, Provided by Fire Department, NFPA PIKE POLE PROVIDED BY FIRE DEPARTMENT There will be one (1) 3' pike pole(s) provided by the fire department. The pike pole(s) will be a Duo-Safety 3' Pike Pole. 0770578 Pike Pole Tubes, in Torque Box/Ladder Storage, ABS PIKE POLE STORAGE IN TORQUE BOX/LADDER STORAGE There will be ABS tubing provided in the torque box/ladder storage area for a total of three (3) pike poles. If the head of a pike pole can come into contact with a painted surface, a stainless steel scuffplate will be provided. 0024388 No Steps Required, Front Of Body 39751Bid #: 0014456 Pump, Hale, QMAX-200, 2000 GPM, Single Stage MIDSHIP FIRE PUMP Midship fire pump will be a Hale QMAX-200, 2000 gpm single (1) stage midship mounted centrifugal type. Pump will be the class "A" type. Pump will deliver the percentage of rated discharges at the pressures indicated below: - 100% of rated capacity at 150 psi net pump pressure. - 100% of rated capacity at 165 psi net pump pressure. - 70% of rated capacity at 200 psi net pump pressure. - 50% of rated capacity at 250 psi net pump pressure. Entire pump and both suction and discharge passages will be hydrostatically tested to a pressure of 500 psi. Pump will be fully tested at the pump manufacturer's factory to the performance requirements as outlined by the current NFPA 1901 standards and will be free from objectionable pulsation and vibration. Pump body and related parts will be of fine grain, alloy cast iron with a minimum tensile strength of 30,000 psi (2041.2 bar). All moving parts in contact with water will be of high quality bronze or stainless steel. Pump body will be horizontally split, on a single plane in two (2) sections, for easy removal of entire impeller assembly, including wear rings and bearings from beneath the pump, without disturbing pump piping or the mounting of the pump in the chassis. Pump will have one (1) double suction impeller. The pump body will have two (2) opposed discharge volute cutwaters to eliminate radial unbalance. Pump impeller will be hard, fine grain bronze of the mixed flow design; accurately machined, hand-ground and individually balanced. The vanes of the impeller intake eyes will be hand- ground and polished to a sharp edge. They will be of sufficient size and design to provide ample reserve capacity utilizing minimum horsepower. Impeller clearance rings will be bronze and easily renewable without replacing impeller or pump volute body. They will be of the wrap-around double labyrinth design for maximum efficiency. Pump shaft will be electric furnace heat-treated, corrosion resistant stainless steel. It will be super-finished under packing with galvanic corrosion (zinc separators in packing) protection for longer shaft life. Pump shaft will be sealed with double oil seal to keep road dirt and water out of drive unit. Pump shaft will be rigidly supported by three (3) bearings for minimum deflection. A high lead bronze sleeve bearing will be located immediately adjacent to the impeller (on the side opposite of the drive unit). The sleeve bearing will be automatically oil lubricated and pressure balanced to exclude foreign material. The remaining bearings will be heavy-duty, deep groove ball bearings in the gearbox and will be splash lubricated. 0014482 Seal, Mechanical, Hale MECHANICAL SEAL ON PUMP Only one (1) mechanical seal will be used on the suction (inboard) side of the pump. The mechanical seal will be 2.00" in diameter and will be spring loaded, maintenance-free, and self- adjusting. The mechanical seal construction will be a carbon sealing ring, stainless steel coil spring, Viton® rubber boot, and a tungsten carbide seat with a Teflon backup seal. 0014477 Trans, Pump, Hale, Gear PUMP TRANSMISSION The drive unit will be cast and completely manufactured and tested at the Hale Products, Inc. factory. The pump drive unit will be of sufficient size to withstand up to 16,000 foot/ pounds of torque from the engine in both the road and pump operating conditions. The drive unit is will be designed with ample lubrication reserve to maintain the proper operating temperature. The gearbox drive shafts will be of heat treated chrome nickel steel and 2.75" in diameter on both the input and output drive shafts. They will be designed to withstand the full torque of the engine in both road and pump operating conditions. All gears, both drive and pump, will be of the highest quality, electric furnace, chrome nickel steel. Bores will be ground to size and teeth integrated, crown-shaved and hardened, to give an extremely accurate gear for long life, smooth, quiet running and higher load carrying capability. An accurately cut spur design will be provided to eliminate all possible end thrust. Pierce Manufacturing will select the pump ratio to provide the maximum performance with the engine and transmission selected. Three (3) green warning lights will be provided to indicate to the operator(s) when the pump has completed the shift from Road to Pump position. Two (2) lights will be located in the truck driving compartment and one (1) light on pump operator's panel adjacent to the throttle control. 0635600 Pumping Mode, Stationary Only PUMPING MODE An interlock system will be provided to ensure that the pump drive system components are properly engaged so that the apparatus can be safely operated. The interlock system will be designed to allow stationary pumping only. 40751Bid #: 0604324 Pump Shift, Air w/Manual Override, Split Shaft, Interlocked, Hale AIR PUMP SHIFT Pump shift engagement will be made by a two (2) position sliding collar, actuated pneumatically (by air pressure), with a three (3) position air control switch located in the cab. A manual back-up shift control will also be located on the left side pump panel. Two (2) indicator lights will be provided adjacent to the pump shift inside the cab. One (1) green light will indicate the pump shift has been completed and be labeled "pump engaged". The second green light will indicate when the pump has been engaged and the chassis transmission is in pump gear. This indicator light will be labeled "OK to pump". Another green indicator light will be installed adjacent to the hand throttle on the pump panel and indicate either the pump is engaged and the road transmission is in pump gear, or the road transmission is in neutral and the pump is not engaged. This light will be labeled "Warning: Do not open throttle unless light is on". The pump shift will be interlocked to prevent the pump from being shifted out of gear when the chassis transmission is in gear to meet NFPA requirements. The pump shift control in the cab will be illuminated to meet NFPA requirements. 0003148 Transmission Lock-up, EVS TRANSMISSION LOCK-UP The direct gear transmission lock-up for the fire pump operation will engage automatically when the pump shift control in the cab is activated. 0004547 Auxiliary Cooling System AUXILIARY COOLING SYSTEM A supplementary heat exchange cooling system will be provided to allow the use of water from the discharge side of the pump for cooling the engine water. The heat exchanger will be cylindrical type and will be a separate unit. The heat exchanger will be installed in the pump or engine compartment with the control located on the pump operator's control panel. Exchanger will be plumbed to the master drain valve. 0014486 Not Required, Transfer Valve, Stage Pump 0783096 Valve, Relief Intake, Trident Air Max, Control at Operator Panel INTAKE RELIEF VALVE A Trident Air Max intake relief valve will be installed on the suction side of the pump preset at 125 PSI. The relief valve will have a working range of 50 PSI to 350 PSI. The outlet will terminate below the frame rails with a 2.50" National Standard hose thread adapter and will have a "do not cap" warning tag. An adjustable air regulator and pressure indicating gauge will be located at the pump operator's panel on a common bezel. 0794959 Controller, Pressure, Pierce, Pump Boss, PBA300 PRESSURE CONTROLLER A Pierce Pump Boss Model PBA300 pressure governor will be provided. A pressure transducer will be installed in the water discharge manifold on the pump. The display panel will be located at the pump operator's panel. 0072153 Primer, Trident, Air Prime, Air Operated PRIMING PUMP The priming pump will be a Trident Emergency Products compressed air powered, high efficiency, multistage venturi based AirPrime System, conforming to standards outlined in the current edition of NFPA 1901. All wetted metallic parts of the priming system are to be of brass and stainless steel construction. One (1) priming control will open the priming valve and start the pump primer. 0780364 Manuals, Pump, (2) Total, Electronic Copies PUMP MANUALS There will be a total of two (2) pump manuals provided by the pump manufacturer and furnished with the apparatus. The manuals will be provided by the pump manufacturer in the form of two (2) electronic copies. Each manual will cover pump operation, maintenance, and parts. 0602512 Plumbing, Stainless Steel and Hose, Single Stage Pump, Control Zone PLUMBING, STAINLESS STEEL AND HOSE All inlet and outlet lines will be plumbed with either stainless steel pipe, flexible polypropylene tubing or synthetic rubber hose reinforced with hi-tensile polyester braid. All hose's will be equipped with brass or stainless steel couplings. All stainless steel hard plumbing will be a minimum of a schedule 10 wall thickness. Where vibration or chassis flexing may damage or loosen piping or where a coupling is required for servicing, the piping will be equipped with victaulic or rubber couplings. Plumbing manifold bodies will be ductile cast iron or stainless steel. All piping lines are to be drained through a master drain valve or will be equipped with individual drain valves. All drain lines will be extended with a hose to drain below the chassis frame. All water carrying gauge lines will be of flexible polypropylene tubing. All piping, hose and fittings will have a minimum of a 500 PSI hydrodynamic pressure rating. 0795135 Plumbing, Stainless Steel, w/Foam System PLUMBING, FOAM SYSTEM All piping that is in contact with the foam concentrate or foam/water solution will be stainless steel. The fittings will be stainless steel or brass. Cast iron pump manifolds will be allowed. 41751Bid #: 0004645 Inlets, 6.00" - 1250 GPM or Larger Pump MAIN PUMP INLETS A 6.00" pump manifold inlet will be provided on each side of the vehicle. The suction inlets will include removable die cast zinc screens that are designed to provide cathodic protection for the pump, thus reducing corrosion in the pump. 0004646 Cap, Main Pump Inlet, Long Handle, NST, VLH MAIN PUMP INLET CAP The main pump inlets will have National Standard Threads with a long handle chrome cap. The cap will be the Pierce VLH, which incorporates an exclusive thread design to automatically relieve stored pressure in the line when disconnected. 0084610 Valves, Akron 8000 series- All VALVES All ball valves will be Akron® Brass. The Akron valves will be the 8000 series heavy-duty style with a stainless steel ball and a simple two-seat design. No lubrication or regular maintenance is required on the valve. Valves will have a ten (10) year warranty. 0004660 Inlet, Left Side, 2.50"LEFT SIDE INLET There will be one (1) auxiliary inlet with a 2.50" valve at the left side pump panel, terminating with a 2.50" (F) National Standard hose thread adapter. The auxiliary inlet will be provided with a strainer, chrome swivel and plug. 0029147 Not Required, Inlet, Right Side 0016158 Valve, Inlet(s) Recessed, Side Cntrl, "Control Zone" The location of the valve for the one (1) inlet will be recessed behind the pump panel. 0004700 Control, Inlet, at Valve INLET CONTROL The side auxiliary inlet(s) will incorporate a quarter-turn ball valve with the control located at the inlet valve. The valve operating mechanism will indicate the position of the valve. 0092569 No Rear Inlet (Large Dia) Requested 0092696 Not Required, Cap, Rear Inlet 0064116 No Rear Inlet Actuation Required 0009648 No Rear Intake Relief Valve Required on Rear Inlet 0092568 No Rear Auxiliary Inlet Requested 0563738 Valve, .75" Bleeder, Aux. Side Inlet, Swing Handle INLET BLEEDER VALVE A 0.75" bleeder valve will be provided for each side gated inlet. The valves will be located behind the panel with a swing style handle control extended to the outside of the panel. The handles will be chrome plated and provide a visual indication of valve position. The swing handle will provide an ergonomic position for operating the valve without twisting the wrist and provides excellent leverage. The water discharged by the bleeders will be routed below the chassis frame rails. 0029043 Tank to Pump, (1) 3.00" Valve, 3.00" Plumbing TANK TO PUMP The booster tank will be connected to the intake side of the pump with stainless steel piping and a quarter turn 3.00" full flow line valve with the control remotely located at the operator's panel. Tank to pump line will run straight (no elbows) from the pump into the front face of the water tank and angle down into the tank sump. A rubber coupling will be included in this line to prevent damage from vibration or chassis flexing. A check valve will be provided in the tank to pump supply line to prevent the possibility of "back filling" the water tank. 0004905 Outlet, Tank Fill, 1.50"TANK REFILL A 1.50" combination tank refill and pump re-circulation line will be provided, using a quarter-turn full flow ball valve controlled from the pump operator's panel. 0004940 Outlet, Left Side, 2.50"LEFT SIDE DISCHARGE OUTLETS There will be one (1) discharge outlet with a 2.50" valve on the left side of the apparatus, terminating with a 2.50" (M) National Standard hose thread adapter. 42751Bid #: 0092570 Not Required, Outlets, Left Side Additional 0004945 Outlet, Right Side, 2.50"RIGHT SIDE DISCHARGE OUTLETS There will be one (1) discharge outlet with a 2.50" valve on the right side of the apparatus, terminating with a 2.50" (M) National Standard hose thread adapter. 0092571 Not Required, Outlets, Right Side Additional 0005047 Outlet, 4" w/4" Right, Handwheel LARGE DIAMETER DISCHARGE OUTLET There will be a 4.00" discharge outlet with a 4.00" Akron valve installed on the right side of the apparatus, terminating with a 4.00" (M) National Standard hose thread adapter. This discharge outlet will be actuated with a handwheel control at the pump operator's control panel. An indicator will be provided to show when the valve is in the closed position. 0648906 Outlet, Front, 2.50" w/2.50" Plumbing FRONT DISCHARGE OUTLET There will be one (1) 2.50" discharge outlet piped to the front of the apparatus and located on the top of the right side of the front bumper. Plumbing will consist of 2.50" piping and flexible hose with a 2.50" full flow valve with control at the pump operator's panel. A fabricated weldment made of stainless steel pipe will be used in the plumbing where appropriate. The piping will terminate with a 2.50" NST with 90 degree stainless steel swivel. There will be automatic drains provided at all low points of the piping. 0092575 Not Required, Outlet, Rear 0092574 Not Required, Outlet, Rear, Additional 0092573 Not Required, Outlet, Hose Bed/Running Board Tray 0085076 Caps for 1.50" to 3.00" Discharge, VLH DISCHARGE CAPS Chrome plated, rocker lug, caps with chains will be furnished for all side discharge outlets. The caps will be the Pierce VLH, which incorporates an exclusive thread design to automatically relieve stored pressure in the line when disconnected. 0563739 Valve, 0.75" Bleeder, Discharges, Swing Handle OUTLET BLEEDER VALVE A 0.75" bleeder valve will be provided for each outlet 1.50" or larger. Automatic drain valves are acceptable with some outlets if deemed appropriate with the application. The valves will be located behind the panel with a swing style handle control extended to the outside of the side pump panel. The handles will be chrome plated and provide a visual indication of valve position. The swing handle will provide an ergonomic position for operating the valve without twisting the wrist and provides excellent leverage. Bleeders will be located at the bottom of the pump panel. They will be properly labeled identifying the discharge they are plumbed in to. The water discharged by the bleeders will be routed below the chassis frame rails. 0005091 Elbow, Left Side Outlets, 45 Degree, 2.50" FNST x 2.50" MNST, VLH LEFT SIDE OUTLET ELBOWS The 2.50" discharge outlets located on the left side pump panel will be furnished with a 2.50" (F) National Standard hose thread x 2.50" (M) National Standard hose thread, chrome plated, 45 degree elbow. The elbow will be Pierce VLH, which incorporates an exclusive thread design to automatically relieve stored pressure in the line when disconnected. 0035094 Not Required, Elbow, Left Side Outlets, Additional 0025091 Elbow, Right Side Outlets, 45 Degree, 2.50" FNST x 2.50" MNST, VLH RIGHT SIDE OUTLET ELBOWS The 2.50" discharge outlets located on the right side pump panel will be furnished with a 2.50" (F) National Standard hose thread x 2.50" (M) National Standard hose thread, chrome plated, 45 degree elbow. The elbow will be Pierce VLH, which incorporates an exclusive thread design to automatically relieve stored pressure in the line when disconnected. 0089584 Not Required, Elbow, Right Side Outlets, Additional 43751Bid #: 0045099 Not Required, Elbow, Rear Outlets 0085695 Not Required, Elbow, Rear Outlets, Large, Additional 0005097 Elbow, Large Dia Outlet, 30 Deg, 4.00" FNST x 5.00" Storz LARGE DIAMETER OUTLET ELBOWS The 4.00" outlet(s) will be furnished with one (1) 4.00" (F) National Standard hose thread x 5.00" Storz elbow adapter with Storz cap. 0062133 Control, Outlets, Manual, Pierce HW if applicable DISCHARGE OUTLET CONTROLS The discharge outlets will incorporate a quarter-turn ball valve with the control located at the pump operator's panel. The valve operating mechanism will indicate the position of the valve. If a handwheel control valve is used, the control will be a minimum of a 3.9" diameter stainless steel handwheel with a dial position indicator built in to the center of the handwheel. 0029106 Not Required, Deluge Outlet 0029302 No Monitor Requested 0029304 No Nozzle Req'd 0029107 No Deluge Mount 0047583 Waterway Outlet & Control, 4" Akron, Handwheel AERIAL OUTLET The aerial waterway will be plumbed from the pump to the water tower line with 5.00" pipe and a 4.00" Akron valve. The handwheel control for the waterway valve will be located at the pump operator's panel. An indicator will be provided to show the position of the valve. 0029167 Crosslays Sngl Sheet Unpainted, (2+) 1.50", Std. Cap CROSSLAY HOSE BEDS Two (2) crosslays with 1.50" outlets will be provided. Each bed to be capable of carrying 200' of 1.75" double jacketed hose and will be plumbed with 2.00" i.d. pipe and gated with a 2.00" quarter turn ball valve. Outlets to be equipped with a 1.50" National Standard hose thread 90 degree swivel located in the hose bed so that hose may be removed from either side of apparatus. The crosslay controls will be at the pump operator's panel. The center crosslay dividers will be fabricated of 0.25" aluminum and will provide adjustment from side to side. The divider will be unpainted with a brushed finish. Vertical scuffplates constructed of stainless steel will be provided at the front and rear ends of the bed on each side of vehicle. Crosslay bed flooring will consist of removable perforated brushed aluminum. 0090442 Crosslays Sngl Sheet Unpainted, (1) 2.50" Std Cap 2.50" CROSSLAY HOSE BED One (1) crosslay with 2.50" outlets will be provided. This bed to be capable of carrying 200' of 2.50" double jacketed hose and will be plumbed with 2.50" i.d. pipe and gated with a 2.50" quarter turn ball valve. Outlet to be equipped with a 2.50" National Standard hose thread 90 degree swivel located in the hose bed so that hose may be removed from either side of apparatus. The crosslay control will be at the pump operator's panel. The center crosslay dividers will be fabricated of 0.25" aluminum and will provide adjustment from side to side. The divider will be unpainted with a brushed finish. The remainder of the crosslay bed will be painted job color. Stainless steel vertical scuffplates will be provided at hose bed ends (each side of vehicle). Bottom of hose bed ends (each side) will also be equipped with a stainless steel scuffplate. Crosslay bed flooring will consist of removable perforated brushed aluminum. 0029260 Not Required, Speedlays 0590942 Hose Restraint, Crosslay/Deadlay, 1" Heavy Nylon Web, Strap Fasteners, Each Side CROSSLAY/DEADLAY HOSE RESTRAINT A black 1.00" nylon webbing design with 2.00" box pattern will be provided across each end of three (3) crosslay/deadlay(s) to secure the hose during travel. The webbing will be permanently attached at the front of the crosslay/deadlay opening(s). 1.00" web straps will loop through footman loops located at the opposite end of the permanently attached webbing. The straps will attach with a pair of spring clip and hook fasteners. 44751Bid #: 0075206 Cover, Crosslay, Bi-fold 3\16" Alum Treadplate CROSSLAY COVER A bi-fold .19" aluminum treadplate cover will be installed over the crosslay hose beds. It will include a latch at each end of the cover to hold it securely in place, a chrome grab handle at each end for opening and closing the cover and a foam rubber gasket where the cover comes into contact to a painted surface. 0019853 Crosslays, 8.00" Lower Than Standard - Control Zone w/9.00" Raised PH CROSSLAY 8.00" LOWER THAN STANDARD The crosslays will be lowered 8.00" from standard. 0025299 Crosslays, Unpainted, D/A Finish CROSSLAYS UNPAINTED The walls of the crosslays and the crosslay divider will be unpainted with a DA finish. 0007827 Foam Sys, FoamPro 2002 (Single Agent) FOAM CONCENTRATE PROPORTIONING SYSTEM A Hypro FoamPro®, Model 2002, foam system will be provided as the means for the proportioning of foam concentrate into the water stream. The FoamPro is an electronic, fully automatic, variable speed, direct injection, discharge side foam proportioning system. This system will be a single agent system capable of handling Class A foam concentrates, as well as most Class B foam concentrates. The foam system will be plumbed to five (5) discharges. The discharges capable of dispensing foam will be four preconnects and the DS 2.5". The foam proportioning system operation will be based on a direct measurement of water flows, and remain consistent within the specified flow and pressure. The system will be equipped with a digital electronic control display on the pump panel. Incorporated within the control display will be a microprocessor, which receives input from the system flow meter while also monitoring the foam concentrate pump output. The microprocessor will compare the values of the water flow versus the foam flow, to ensure the proportion rate is accurate. One (1) paddle wheel will be installed to monitor all foam discharges. Push button control for the form proportioning rate will allow a ratio from .1 percent to 3 percent in .1 percent increments. The rated capacity of this system will be 166 gpm at 3 percent and 1000 gpm at .5 percent. A 5 gpm positive displacement foam pump will be powered by a 12 vdc electric motor. One (1) check valve will be installed in the plumbing to prevent foam from contaminating the water pump. The check valve will be approved by the foam system manufacturer. 0012126 Not Required, CAF Compressor 0552663 Foam Refill, Pump, Foam Pro, Power-Fill FOAM REFILL PUMP A 12v pump will be permanently mounted in the pump compartment. A male quick disconnect fitting will be provided on the pump panel and a pick-up wand with a 6' tube and mating female fitting will be provided loose. The control switch for the pump will be located on the pump panel adjacent to the quick disconnect fitting. The pump will be plumbed to the foam tank allowing the user to refill the foam tank from the ground. 0031896 Demonstration, Foam System, Dealer Provided 0022539 Foam Cell, 20 Gallon, Reduce Water FOAM TANK The foam tank will be an integral portion of the polypropylene water tank. The cell will have a capacity of 20 gallons of foam with the intended use of Class A foam. The foam cell will reduce the capacity of the water tank. The foam cell will have a screen in the fill dome and a breather in the lid. 0091036 Drain, 1.00" Foam Tank #1 FOAM TANK DRAIN The foam tank drain will be a 1.00" drain valve located inside the pump compartment accessible through a door on the right side pump panel. 0091079 Not Required, Foam Tank #2 0091112 Not Required, Foam Tank #2 Drain 45751Bid #: 0620530 Pump House, Side Control, 52", Control Zone, Aerial PUMP COMPARTMENT The pump compartment will be separate from the hose body and compartments so that each may flex independently of the other. The pump compartment will be constructed of the same material as the body compartmentation. The pump compartment substructure will be a fabricated assembly of steel tubing, angles and channels which supports both the fire pump and the side running boards. The pump compartment will be mounted on the chassis frame rails with rubber biscuits in a four point pattern to allow for chassis frame twist. Pump compartment, pump, plumbing and gauge panels will be removable from the chassis in a single assembly. PUMP MOUNTING Pump will be mounted to a substructure which will be mounted to the chassis frame rail using rubber isolators. The mounting will allow chassis frame rails to flex independently without damage to the fire pump. LEFT SIDE PUMP CONTROL PANELS All pump controls and gauges will be located at the left (driver's) side of the apparatus and properly identified. Layout of the pump control panel will be ergonomically efficient and systematically organized. The pump operator's control panel will be removable in two (2) main sections for ease of maintenance: The upper section will contain sub panels for the mounting of the pump pressure control device, engine monitoring gauges, electrical switches, and foam controls (if applicable). Sub panels will be removable from the face of the pump panel for ease of maintenance. Below the sub panels will be located all valve controls and line pressure gauges. The lower section of the panel will contain all inlets, outlets, and drains. All push/pull valve controls will have 1/4 turn locking control rods with polished chrome plated zinc tee handles. Guides for the push/pull control rods will be chrome plated zinc castings securely mounted to the pump panel. Push/pull valve controls will be capable of locking in any position. The control rods will pull straight out of the panel and will be equipped with universal joints to eliminate binding. IDENTIFICATION TAGS The identification tag for each valve control will be recessed in the face of the tee handle. All discharge outlets will have color coded identification tags, with each discharge having its own unique color. Color coding will include the labeling of the outlet and the drain for each corresponding discharge. All line pressure gauges will be mounted directly above the corresponding discharge control tee handles and recessed within the same chrome plated casting as the rod guide for quick identification. The gauge and rod guide casting will be removable from the face of the pump panel for ease of maintenance. The casting will be color coded to correspond with the discharge identification tag. All remaining identification tags will be mounted on the pump panel in chrome plated bezels. The pump panel on the right (passenger's) side will be removable with lift and turn type fasteners. Trim rings will be installed around all inlets and outlets. 0032479 Pump Panel Configuration, Control Zone PUMP PANEL CONFIGURATION The pump panel configuration will be arranged and installed in an organized manner that will provide user-friendly operation. 0562698 Step, Slide-Out/Fold-Out, Pump Operator Platform, Aerial PUMP OPERATOR'S PLATFORM A pull out, flip down platform will be provided at the pump operator's control panel. The front edge and the top surface of the platform will be made of DA finished aluminum with a Morton Cass insert. The platform will be approximately 13.75" deep when in the stowed position and approximately 22.00" deep when extended. The platform will be 35.00" wide. The platform will lock in the retracted and the extended position. The platform will be wired to the "step not stowed" indicator in the cab. 0667186 Light, Slide-Out Pump Operator Step, On Scene Solutions Access LED, Short Step PUMP OPERATOR'S PLATFORM PERIMETER LIGHT There will be an On Scene Solutions, Model Night Stick Access, 20.00" white 12 volt DC LED strip light provided to illuminate the ground area. 0635355 Material, Pump Panels, Side Control Painted FormCoat Black PUMP AND GAUGE PANEL The pump and gauge panels will be constructed of aluminum with a painted FormCoat black finish. A polished aluminum trim molding will be provided around each panel. 0005578 Panel, Pump Access - Right Side Only The right side pump panel will be removable and fastened with swell type fasteners. 0035501 Pump House Structure, Std Height 0583824 Light, Pump Compt, Wln 3SC0CDCR LED White PUMP COMPARTMENT LIGHT There will be one (1) Whelen®, Model 3SC0CDCR, 3.00" white 12 volt DC LED light(s) with Whelen, Model 3FLANGEC, flange(s) installed in the pump compartment. There will be a switch accessible through a door on the pump panel included with this installation. 46751Bid #: 0586382 Gauges, Engine, Included With Pressure Controller Engine monitoring graduated LED indicators will be incorporated with the pressure controller. Also provided at the pump panel will be the following: - Master Pump Drain Control 0005601 Throttle Included w/ Pressure Controller 0549333 Indicators, Engine, Included with Pressure Controller 0511078 Gauges, 4.00" Master, Class 1, 30"-0 -600psi VACUUM AND PRESSURE GAUGES The pump vacuum and pressure gauges will be liquid filled and manufactured by Class 1 Incorporated ©. The gauges will be a minimum of 4.00" in diameter and will have white faces with black lettering, with a pressure range of 30.00"-0-600#. Gauge construction will include a Zytel nylon case with adhesive mounting gasket and threaded retaining nut. The pump pressure and vacuum gauges will be installed adjacent to each other at the pump operator's control panel. Test port connections will be provided at the pump operator's panel. One will be connected to the intake side of the pump, and the other to the discharge manifold of the pump. They will have 0.25 in. standard pipe thread connections and non-corrosive polished stainless steel or brass plugs. They will be marked with a label. This gauge will include a 10 year warranty against leakage, pointer defect, and defective bourdon tube. 0511100 Gauge, 2.00" Pressure, Class 1, 30"- 0-400psi PRESSURE GAUGES The individual "line" pressure gauges for the discharges will be Class 1© interlube filled. They will be a minimum of 2.00" in diameter and have white faces with black lettering. Gauge construction will include a Zytel nylon case with adhesive mounting gasket and threaded retaining nut. Gauges will have a pressure range of 30"-0-400#. The individual pressure gauge will be installed as close to the outlet control as practical. This gauge will include a 10 year warranty against leakage, pointer defect, and defective bourdon tube. 0062586 Gauge, Water Level, Class 1, Pierce Std WATER LEVEL GAUGE There will be an electronic water level gauge provided on the operator's panel that registers water level by means of five (5) colored LED lights. The lights will be durable, ultra-bright five (5) LED design viewable through 180 degrees. The water level indicators will be as follows: 100 percent = Green 75 percent = Yellow 50 percent = Yellow 25 percent = Yellow Refill = Red The light will flash when the level drops below the given level indicator to provide an eighth of a tank indication. To further alert the pump operator, the lights will flash sequentially when the water tank is empty. The level measurement will be based on the sensing of head pressure of the fluid in the tank. The display will be constructed of a solid plastic material with a chrome plated die cast bezel to reduce vibrations that can cause broken wires and loose electronic components. The encapsulated design will provide complete protection from water and environmental elements. An industrial pressure transducer will be mounted to the outside of the tank. The field calibratable display measures head pressure to accurately show the tank level. 0062992 Gauge, Foam Level, (1) Tank, Class 1, 5lt FOAM LEVEL GAUGE An electronic foam level gauge will be provided on the operator's panel that registers foam level by means of five (5) colored LED lights. The lights will be durable, ultra-bright five (5) LED design viewable through 180 degrees. The foam level indicators will be as follows: 100 percent = Green 75 percent = Yellow 50 percent = Yellow 25 percent = Yellow Refill = Red The light will flash when the level drops below the given level indicator to provide an eighth of a tank indication. To further alert the pump operator, the lights will flash sequentially when the foam tank is empty. The level measurement will be based on the sensing of head pressure of the fluid in the tank. The display will be constructed of a solid plastic material with a chrome plated die cast bezel to reduce vibrations that can cause broken wires and loose electronic components. The encapsulated design will provide complete protection from foam and environmental elements. An industrial pressure transducer will be mounted to the outside of the tank. The display will be able to be calibrated in the field and will measure head pressure to accurately show the tank level. 47751Bid #: 0682503 Light Shield/Step 8" LED, P25 LED Step Light STEP/LIGHT SHIELD There will be an aluminum treadplate stepping surface no less than 8.00" deep and properly reinforced to support a man's weight, installed over the pump operators panel. There will be 12 volt DC white LED lights installed under the step to illuminate the controls, switches, essential instructions, gauges, and instruments necessary for the operation of the apparatus. These lights will be activated by the pump panel light switch. Additional lights will be included every 18.00" depending on the size of the pump house. One (1) pump panel light will come on when the pump is in ok to pump mode. There will be a light activated above the pump panel light switch when the parking brake is set. This is to afford the operator some illumination when first approaching the control panel. There will be a green pump engaged indicator light activated on at the operator's panel when the pump is shifted into gear from inside the cab. There will be one (1) white LED, step light provided above this step. In order to ensure exceptional illumination, each step light will provide a minimum of 25 foot-candles (fc) covering an entire 15.00" x 15.00" square placed 10.00" below the light and a minimum of 1.5 fc covering an entire 30.00" x 30.00" square at the same 10.00" distance below the light. The step light will be activated by the pump panel light switch. 0606697 Air Horns, (2) Grover, In Bumper AIR HORN SYSTEM There will be two (2) Grover air horns recessed in the front bumper. The horn system will be piped to the air brake system wet tank utilizing 0.38" tubing. A pressure protection valve will be installed in-line to prevent loss of air in the air brake system. 0606835 Location, Air Horns, Bumper, Each Side, Outside Frame, Outboard (Pos #1 & #7) Air Horn Location The air horns will be located on each side of the bumper, towards the outside. 0016065 Control, Air Horn, Horn Ring, PS Chrome Push Button AIR HORN CONTROL The air horns will be actuated by a chrome push button located on the officer's side of the engine tunnel and by the horn button in the steering wheel. The driver will have the option to control the air horns or the chassis horns from the horn button by means of a selector switch located on the instrument panel. 0534828 Siren, Wln 295SL101, 100 or 200W Removable Mic ELECTRONIC SIREN There shall be a Whelen, Model 295SL 101, 100 or 200 watt electronic siren with noise canceling plug-in microphone will be provided. This siren to be active when the battery switch is on and that emergency master switch is on. 0510206 Location, Elect Siren, Recessed Overhead In Console Electronic siren head will be recessed in the driver side inside switch panel. 0076156 Control, Elec Siren, Head Only The electronic siren will be controlled on the siren head only. No horn button or foot switches will be provided. 0601306 Speaker, (1) Wln, SA315P, w/Pierce Polished Stainless Steel Grille, 100 watt SPEAKER There will be one (1) Whelen®, Model SA315P, black nylon composite, 100-watt, speaker with through bumper mounting brackets and polished stainless steel grille provided. The speaker will be connected to the siren amplifier. 0601565 Location, Speaker, Frt Bumper, Recessed, Center (Pos 4) The speaker(s) will be recessed in the center of the front bumper. 0545191 Siren, Auxiliary, Wln HOWLER Speaker System SIREN AMPLIFIER One (1) amplifier will be provided installed with the Whelen Howler system to be used in conjunction with the vehicle's primary electronic siren. AUXILIARY SPEAKERS Two (2) auxiliary speakers will be provided with the Whelen Howler system. These speakers will be installed behind the front bumper or cab, under front bumper . 0016080 Siren, Federal Q2B AUXILIARY MECHANICAL SIREN A Federal Q2B® siren will be furnished. A siren brake button will be installed on the switch panel. The control solenoid will be powered up after the emergency master switch is activated. 0006095 Siren, Mechanical, Mounted Above Deckplate The mechanical siren will be mounted on the bumper deck plate. It will be mounted on the left side. A reinforcement plate will be furnished to support the siren. 0026163 Control, Mech Siren, DS & PS Foot Sw The mechanical siren will be actuated by two (2) foot switches, one (1) located on the officer's side and one (1) on the driver's side. 48751Bid #: 0606715 Lightbar, Wln, Freedom IV-Q, 2- 21.5", RRRRR RRRRR FRONT ZONE UPPER WARNING LIGHTS There will be two (2) 21.50" Whelen Freedom IV LED lightbars mounted on the cab roof, one (1) on each side, above the driver's and passenger's door, facing forward. The driver's side lightbar will include the following: One (1) red flashing LED module in the outside end position. One (1) red flashing LED module in the outside front corner position. One (1) red flashing LED module in the outside front position. One (1) red flashing LED module in the inside front position. One (1) red flashing LED module in the inside front corner position. The passenger's side lightbar will include the following: One (1) red flashing LED module in the inside front corner position. One (1) red flashing LED module in the inside front position. One (1) red flashing LED module in the outside front position. One (1) red flashing LED module in the outside front corner position. One (1) red flashing LED module in the outside end position. There will be clear lenses included on the lightbar. There will be a switch in the cab on the switch panel to control the lightbars. 0691544 Light, GTT, 794* LED Opticom Emitter, Remote Mounted on Cab Roof TRAFFIC LIGHT CONTROLLER There will be a GTT, Model 794* LED Opticom traffic light controller with national standard high priority remote mounted on the front edge of the cab DS of roof. The Opticom traffic light controller will be activated by a cab switch with emergency master control. The Opticom traffic light controller will have no momentary activation switch. The Opticom traffic light controller will be disabled when the parking brake is applied. 0540460 Light, Front Zone, Wln M6*C LED, Clear Lens, 4lts Q Bezel CAB FACE WARNING LIGHTS There will be four (4) Whelen®, Model M6*C, LED flashing warning lights installed on the cab face, above the headlights, mounted in a common bezel. The driver's side front outside warning light to be red The driver's side front inside warning light to be red The passenger's side front inside warning light to be red The passenger's side front outside warning light to be red All four (4) lights will include a clear lens. There will be a switch located in the cab, on the switch panel, to control the four (4) lights. The inside lights may be load managed if colored or disabled if white, when the parking brake is set. 0653937 Flasher, Headlight Alternating HEADLIGHT FLASHER The high beam headlights will flash alternately between the left and right side. There will be a switch installed in the cab on the switch panel to control the high beam flash. This switch will be live when the battery switch and the emergency master switches are on. The flashing will automatically cancel when the hi-beam headlight switch is activated or when the parking brake is set. 0540692 Lights, Side Zone Lower, Wln M6*C LED, Clear Lens, 3pr, Ovr 25 SIDE ZONE LOWER LIGHTING There will be six (6) Whelen®, Model M6*C, flashing LED warning lights with chrome trim installed per the following: Two (2) lights, one (1) each side on the bumper extension. The side front lights to be red. Two (2) lights, one (1) each side of cab rearward of crew cab doors. The side middle lights to be red. Two (2) lights, one (1) each side above rear wheels. The side rear lights to be red. The lights will include clear lenses. There will be a switch in the cab on the switch panel to control the lights. 0564655 Lights, Rear Zone Lower, Wln M6*C LED, Clear Lens, For Tail Lt Housing REAR ZONE LOWER LIGHTING There shall be two (2) Whelen®, Model M6*C, LED flashing warning lights located at the rear of the apparatus. The driver's side rear light to be red The passenger's side rear light to be red Both lights will include a lens that is clear. There will be a switch located in the cab on the switch panel to control the lights. 0088745 Light, Rear Zone Upper, Wln L31HRFN LED Beacon, Red LED REAR/SIDE ZONE UPPER WARNING LIGHTS There will be two (2) Whelen®, Model L31H*FN, LED warning beacons provided at the rear of the truck, located one (1) each side. There will be a switch located in the cab on the switch panel to control the beacons. The color of the lights will be red LEDs with both domes clear. 0006551 Not Required, Lights, Rear Upper Zone Blocking 0006646 Electrical System, 120/240VAC, General Design ELECTRICAL SYSTEM GENERAL DESIGN for ALTERNATING CURRENT The following guidelines will apply to the 120/240 VAC system installation: General 49751Bid #: Any fixed line voltage power source producing alternating current (ac) line voltage will produce electric power at 60 cycles plus or minus 3 cycles. Except where superseded by the requirements of NFPA 1901, all components, equipment and installation procedures will conform to NFPA 70, National Electrical Code (herein referred to as the NEC). Line voltage electrical system equipment and materials included on the apparatus will be listed and installed in accordance with the manufacturer's instructions. All products will be used only in the manner for which they have been listed. Grounding Grounding will be in accordance with Section 250-6 "Portable and Vehicle Mounted Generators" of the NEC. Ungrounded systems will not be used. Only stranded or braided copper conductors will be used for grounding and bonding. An equipment grounding means will be provided in accordance with Section 250-91 (Grounding Conductor Material) of the NEC. The grounded current carrying conductor (neutral) will be insulated from the equipment grounding conductors and from the equipment enclosures and other grounded parts. The neutral conductor will be colored white or gray in accordance with Section 200-6 (Means of Identifying Grounding Conductors) of the NEC. In addition to the bonding required for the low voltage return current, each body and driving or crew compartment enclosure will be bonded to the vehicle frame by a copper conductor. This conductor will have a minimum amperage rating of 115 percent of the nameplate current rating of the power source specification label as defined in Section 310-15 (amp capacities) of the NEC. A single conductor properly sized to meet the low voltage and line voltage requirements will be permitted to be used. All power source system mechanical and electrical components will be sized to support the continuous duty nameplate rating of the power source. Operation Instructions that provide the operator with the essential power source operating instructions, including the power-up and power-down sequence, will be permanently attached to the apparatus at any point where such operations can take place. Provisions will be made for quickly and easily placing the power source into operation. The control will be marked to indicate when it is correctly positioned for power source operation. Any control device used in the drive train will be equipped with a means to prevent the unintentional movement of the control device from its set position. A power source specification label will be permanently attached to the apparatus near the operator's control station. The label will provide the operator with the following information: Rated voltage(s) and type (ac or dc) Phase Rated frequency Rated amperage Continuous rated watts Power source engine speed Direct drive (PTO) and portable generator installations will comply with Article 445 (Generators) of the NEC. Overcurrent protection The conductors used in the power supply assembly between the output terminals of the power source and the main over current protection device will not exceed 144.00" (3658 mm) in length. For fixed power supplies, all conductors in the power supply assembly will be type THHW, THW, or use stranded conductors enclosed in nonmetallic liquid tight flexible conduit rated for a minimum of 194 degree Fahrenheit (90 degrees Celsius). For portable power supplies, conductors located between the power source and the line side of the main overcurrent protection device will be type SO or type SEO with suffix WA flexible cord rated for 600-volts at 194 degrees Fahrenheit (90 degrees Celsius). Wiring Methods Fixed wiring systems will be limited to the following: Metallic or nonmetallic liquid tight flexible conduit rated at not less than 194 degrees Fahrenheit (90 degrees Celsius) or Type SO or Type SEO cord with a WA suffix, rated at 600 volts at not less than 194 degrees Fahrenheit (90 degrees Celsius) Electrical cord or conduit will not be attached to chassis suspension components, water or fuel lines, air or air brake lines, fire pump piping, hydraulic lines, exhaust system components, or low voltage wiring. In addition the wiring will be run as follows. Separated by a minimum of 12.00" (305 mm), or properly shielded, from exhaust piping Separated from fuel lines by a minimum of 6.00" (152 mm) distance Electrical cord or conduit will be supported within 6.00" (152 mm) of any junction box and at a minimum of every 24.00" (610 mm) of continuous run. Supports will be made of nonmetallic materials or corrosion protected metal. All supports will be of a design that does not cut or abrade the conduit or cable and will be mechanically fastened to the vehicle. Wiring Identification All line voltage conductors located in the main panel board will be individually and permanently identified. The identification will reference the wiring schematic or indicate the final termination point. When prewiring for future power sources or devices, the unterminated ends will be labeled showing function and wire size. Wet Locations All wet location receptacle outlets and inlet devices, including those on hardwired remote power distribution boxes, will be of the grounding type provided with a wet location cover and installed in accordance with Section 210-7 "Receptacles and Cord Connections" of the NEC. All receptacles located in a wet location will be not less than 24.00" (610 mm) from the ground. Receptacles on off-road vehicles will be a minimum of 30.00" (762 mm) from the ground. The face of any wet location receptacle will be installed in a plane from vertical to not more than 45 degrees off vertical. No receptacle will be installed in a face up position. Dry Locations All receptacles located in a dry location will be of the grounding type. Receptacles will be not less than 30.00" (762 mm) above the interior floor height. All receptacles will be marked with the type of line voltage (120-volts or 240-volts) and the current rating in amps. If the receptacles are direct current, or other than single phase, they will be so 50751Bid #: marked. Listing All receptacles and electrical inlet devices will be listed to UL 498, Standard for Safety Attachment Plugs and Receptacles, or other appropriate performance standards. Receptacles used for direct current voltages will be rated for the appropriate service. Electrical System Testing The wiring and associated equipment will be tested by the apparatus manufacturer or the installer of the line voltage system. The wiring and permanently connected devices and equipment will be subjected to a dielectric voltage withstand test of 900-volts for one (1) minute. The test will be conducted between live parts and the neutral conductor, and between live parts and the vehicle frame with any switches in the circuit(s) closed. This test will be conducted after all body work has been completed. Electrical polarity verification will be made of all permanently wired equipment and receptacles to determine that connections have been properly made. Operational Test per Current NFPA 1901 Standard The apparatus manufacturer will perform the following operation test and ensure that the power source and any devices that are attached to the line voltage electrical system are properly connected and in working order. The test will be witnessed and the results certified by an independent third-party certification organization. The prime mover will be started from a cold start condition and the line voltage electrical system loaded to 100 percent of the nameplate rating. The power source will be operated at 100 percent of its nameplate voltage for a minimum of two (2) hours unless the system meets category certification as defined in the current NFPA 1901 standard. Where the line voltage power is derived from the vehicle's low voltage system, the minimum continuous electrical load as defined in the current NFPA 1901 standard will be applied to the low voltage electrical system during the operational test. 0563275 Generator, Harrison 6kW MSV, Hydraulic, Hotshift PTO, Volt Meter Only GENERATOR The apparatus will be equipped with a complete AC (alternating current) electrical power system. The generator will be a Harrison, Model MSV, 6,000 watt hydraulic driven unit with vertical exhaust. The generator will be driven by a transmission power take off unit, through a hydraulic pump and motor. The hydraulic engagement supply will be operational at any time (no interlocks). An electric/hydraulic valve will supply hydraulic fluid to the clutch engagement unit provided on the chassis PTO drive. Generator Instruments and Controls To properly monitor the generator performance, a voltmeter will be furnished near the breaker box. 0637440 SP Location, Hydraulic Generator, Front Of Turntable, Reinforced Floor, Aerial GENERATOR LOCATION The generator will be mounted in the area in front of and below the turntable. The flooring in this area will be either reinforced or constructed, in such a manner, that it will handle the additional weight of the generator. 0016752 Starting Sw, Truck Engine Powered Gen, Cab Sw Pnl GENERATOR START There will be a switch provided on the cab instrument panel to engage the generator. 0651902 Remote Start, Hydraulic Generator, 1 Location GENERATOR REMOTE START There will be a generator remote start/stop switch with indicator light located pump panel. 0016740 Not Required, Fuel System 0016767 Not Required, Oil Drain Extension, Generator 0016771 Not Required, Routing Exhaust, Generator 0036738 Circuit Breaker Panel, Included With PTO Generator CIRCUIT BREAKER PANEL The circuit breaker panel will be located high on the back wall of compartment LS4. 51751Bid #: 0006825 Reel, Elect Cable, Hannay, 1600, (3) Wire ELECTRIC CORD REEL Furnished with the 120 volt AC electrical system will be a Hannay, Series 1600, cord reel. The reel will be provided with a 12-volt electric rewind switch, that is guarded to prevent accidental operation and labeled for its intended use. The switch will be protected with a fuse and installed at a height not to exceed 72.00" above the operators standing position. The exterior finish of the reel(s) will be painted #269 gray from the reel manufacturer. A Nylatron guide to be provided to aid in the payout and loading of the reel. A ball stop will be provided to prevent the cord from being wound on the reel. A label will be provided in a readily visible location adjacent to the reel. The label will indicate current rating, current type, phase, voltage and total cable length. A total of one (1) cord reel will be provided one (1) above the pump area, opposite side of the generator. The cord reel will be configured with three (3) conductors. 0006828 Cord, Electric, 10/3 Yellow, 3 Wire CORD Provided for electric distribution will be one (1) length installed on the reel of 150 feet of yellow 10/3 electrical cord, weather resistant 105 degree Celsius to -50 degree Celsius, 600 volt jacketed SOOW cord. A Hubbell L5-20, 20 amp, 120 volt, twist lock connector body will be installed on the end of the cord. 0781579 Receptacle, 15/20A 120V 3-Pr 3-Wr, NEMA 5-20R SB Dup, 1st, Interior Cab 120 VOLT RECEPTACLE There will be two (2), 15/20 amp 120 volt AC three (3) wire straight blade duplex receptacle(s) with interior stainless steel wall plate(s), installed one in each EMS cabinet in the back and low. The NEMA configuration for the receptacle(s) will be 5-20R. The receptacle(s) will be powered from the shoreline inlet. There will be a label installed near the receptacle(s) that state the following: Line Voltage Current Ratting (amps) Phase Frequency Power Source 0519934 Not Required, Brand, Hydraulic Tool System 0649753 Not Required, PTO Driven Hydraulic Tool System 0649750 Not Required, Hydraulic Reels 0786787 Aerial, 107' ASL Single Axle, Active Damping System, 750/500 Tip, 35 MPH Wind FOUR (4)-SECTION 107 FOOT AERIAL LADDER CONSTRUCTION STANDARDS The ladder will be constructed to meet all of the requirements as described in the current NFPA 1901 standards. The aerial device will be a true ladder type device; therefore ladders attached to booms will not be considered. These capabilities will be established in an unsupported configuration. All structural load supporting elements of the aerial device that are made of a ductile material will have a design stress of not more than 50% of the minimum yield strength of the material based on the combination of the live load and the dead load. This 2:1 structural safety factor meets the current NFPA 1901 standard. All structural load supporting elements of the aerial device that are made of non-ductile material will have a design stress of not more than 20% of the minimum ultimate strength of the material, based on the combination of the rated capacity and the dead load. This 5:1 safety factor meets the current 1901 NFPA standard. Wire ropes and attaching systems used to extend and retract the fly sections will have a 5:1 safety factor based on the ultimate strength under all operating conditions. The factor of safety for the wire rope will remain above 2:1 during any extension or retraction stall. The minimum ratio of the diameter of wire rope used to the diameter of the sheave used will be 1:12. Wire ropes will be constructed of seven (7) strands over an inner wire core for increased flexibility. The wire rope will be galvanized to reduce corrosion. The aerial base pivot bearings will be maintenance free type bearings and require no external lubrication. The aerial device will be capable of sustaining a static load one and one-half times its rated tip load capacity (live load) in every position in which the aerial device can be placed when the vehicle is on a firm level surface. The aerial device will be capable of sustaining a static load one and one-third times its rated tip load capacity (live load) in every position the aerial device can be placed when the vehicle is on a slope of five degrees downward in the direction most likely to cause overturning. With the aerial device out of the cradle and in the fully extended position at zero degrees elevation, a test load will be applied in a horizontal direction normal to the centerline of the ladder. The turntable will not rotate and the ladder will not deflect beyond what the product specification allows. All welding of aerial components, including the aerial ladder sections, turntable, pedestal, and outriggers, will be in compliance with the American Welding Society standards. All welding personnel will be certified, as qualified under AWS welding codes. The aerial device will be capable of operating with the maximum rated tip load in either of the two (2) following conditions: - Conditions of high wind up to 35 mph - Conditions of icing, up to a coating of 0.25" over the entire aerial structure 52751Bid #: All of the design criteria must be supported by the following test data: - Strain gage testing of the complete aerial device - Analysis of deflection data taken while the aerial device was under test load The following standards for materials are to be used in the design of the aerial device: - Materials are to be certified by the mill that manufactured the material - Material testing that is performed after the mill test will be for verification only and not with the intent of changing the classification - All welded structural components for the ladder will be traceable to their mill lots LADDER CONSTRUCTION The ladder will be comprised of four sections. The ladder will have the capability to support a minimum of 750 pounds at the tip in the unsupported configuration, based upon 360 degree rotation, up to full extension and from -10 degrees to +77 degrees. The ladder (handrails, baserails, trusses, K-braces and rungs) will be constructed of high strength low alloy steel, minimum 100,000 pounds per square inch yield, with full traceability on all structural members. Each section will be trussed vertically and horizontally using welded steel tubing. All ladder rungs will be welded to each section utilizing "K" bracing for torsional rigidity. The inside width dimensions of the ladder will be: - Base Section 41.87" - Inner-Mid Section 34.88" - Outer-Mid Section 27.87" - Fly Section 21.63" The height of the handrails above the centerline of the rungs will be: - Base Section 26.28" - Inner-Mid Section 22.68" - Outer-Mid Section 20.06" - Fly Section 17.32" The ladder will be designed to provide continuous egress for firefighters and civilians from an elevated position to the ground. The end of the fly section will be constructed in a manner that aids personnel in climbing off the ladder. The egress section will be designed to maintain the rated load of the aerial device. It will be bolted on for easy replacement. There will be a tow eye welded on to each side of the egress. ACTIVE DAMPING SYSTEM (ADS) The aerial device will be equipped with an Active Damping System (ADS). This active damping system will understand the accelerations or forces that are acting on the aerial device and counteract these forces to reduce the vertical displacement of the device, resulting in a more rigid or stiff aerial device. The active damping system will perform as follows: during aerial operation with a full extended device at zero degrees elevation, a load of 250lb will be applied to the tip of the device. Upon removal of this 250lb tip load, the vertical displacement of the aerial device will be reduced by 80% within 10 seconds. VERTICAL HEIGHT The ladder will extend to a minimum height of 107' above the ground at full extension and elevation. The measurement of height will be consistent with NFPA standards. HORIZONTAL REACH The rated horizontal reach will be a minimum of 100'. The measurement of horizontal reach will be consistent with NFPA standards. TURNTABLE The upper turntable assembly will connect the aerial ladder to the turntable bearing. The steel structure will have a mounting position for the aerial elevation cylinders, ladder connecting pins, and upper turntable operator's position. The turntable will be a 0.375" thick aluminum plate, coated with a non-skid, chemical resistant material in the walking areas. The stepping surfaces will meet the skid-resistance requirements of the current NFPA 1901 standard. The turntable will be modified at the passenger side to allow for easier access to the hose bed for hose loading. The portion of the turntable outboard of the rotational motor will be omitted, and the handrails will be modified as required. The turntable handrails will be a minimum 42.00" high and will not increase the overall travel height of the vehicle. The handrails will be constructed from aluminum and have a slip resistant knurled surface. ELEVATION SYSTEM Dual 5.50" diameter elevating cylinders will be mounted on the underside of the base section of the ladder, one (1) on each side. One (1) 2.25" diameter stainless steel pin will fasten each cylinder to the ladder and one (1) 2.50" diameter stainless steel pin will fasten each cylinder to the turntable. The pins will have 125,000 psi minimum yield strength and will be secured with 0.50" Grade 8 bolts with castle nut and cotter pin. The bolts are to ensure that the pins do not walk out of the mounting brackets on the turntable and base section. The elevating cylinders will be mounted utilizing maintenance-free spherical bearings on both ends of the cylinders. The aerial base pivot bearings will be maintenance-free type bearings with no external lubrication required.The cylinders will function only to elevate the ladder and not as a structural member to stabilize the ladder side movement. The elevating cylinders will be provided with pilot-operated check valves on the barrel and rod side of the piston to prevent movement of the ladder in case of a loss of hydraulic pressure. The operation envelope will be 10 degrees below horizontal to 77 degrees above horizontal. The elevation system will be designed following NFPA standards. The elevation hydraulic cylinders will incorporate cushions on the upper limit of travel. The lift cylinders will be equipped with integral holding valves located in the cylinder to prevent the unit from descending should the charged lines be severed, at any point within the hydraulic system and to maintain the ladder in the bedded position during road travel. The integral holding valves will NOT be located in the transfer tubes. The elevation system will be controlled by the microprocessor. Linear transducers will measure the extension of the elevation cylinder. The microprocessor will provide the following features: - Collision avoidance of the elevation system to prevent accidental body damage - Automatic deceleration when the aerial device is lowered into the cradle 53751Bid #: - Automatic deceleration at the end of stroke, in maximum raise and lower positions - Deceleration of the aerial device at the limits of travel. EXTENSION/RETRACTION SYSTEM A hydraulically powered, extension and retraction system will be provided through dual hydraulic cylinders and wire ropes. Each set will be capable of operating the ladder in the event of a failure, of the other. The extension cylinder rod will be chrome plated to provide smooth operation of the aerial device and reduce seal wear. The extension/retraction cylinders will be equipped, with integral holding valves, to prevent the unit from retracting should the charged line be severed, at any point within the hydraulic system. The integral holding valves will NOT be located in the transfer tubes. Wire ropes and attaching systems used to extend and retract the fly sections will have a 5:1 safety factor based on the ultimate strength under all operating conditions. The factor of safety for the wire rope will remain above 2:1 during any extension or retraction stall. The minimum ratio of the diameter of wire rope used to the diameter of the sheave used will be 1:12. Wire ropes will be constructed of seven (7) strands over an inner wire for increased flexibility. The wire rope will be galvanized to reduce corrosion. The extension/retraction system will be controlled by the microprocessor. Linear transducers will measure the ladder extension. The microprocessor will provide the following features: - Automatic deceleration at the end of stroke, in maximum extend and retract positions All sheaves will require lubrication. They will have bronze bushings and grease zerks. MANUAL OVERRIDE CONTROLS Manual override controls will be provided for all aerial and stabilizer functions. LADDER SLIDE MECHANISM UHMW polyethylene wear pads will be used between the telescoping ladder sections, to provide greater bearing surface area for load transfer. Adjustable slide pads will be used to control side play between the ladder sections. ROTATION SYSTEM The aerial will be supplied with a powered rotation system as outlined in NFPA standards. The hydraulic rotation motor will provide continuous rotation under all rated conditions and be supplied with a brake to prevent unintentional rotation. One (1) hydraulically driven, planetary gear box with drive speed reducers will be used to provide infinite and minute rotation control throughout the entire rotational travel. One (1) spring applied, hydraulically released disc type swing brake will be furnished to provide positive braking of the turntable assembly. Provisions will be made for emergency operation of the rotation system should complete loss of normal hydraulic power occur. The hydraulic system will be equipped with pressure relief valves which will limit the rotational torque to a nondestructive power. The gearbox will have a minimum continuous torque rating of 80,000 in. lbs. and a minimum intermittent rating of 160,000 in. lbs. The turntable bearing, ring gear teeth, pinion gear, planetary gearbox,and output shaft will be certified by the manufacturer of the components for the application. The rotation system will be controlled by the microprocessor. The microprocessor will provide the following features: - Collision avoidance to prevent accidental body damage - Prevent the aerial from being rotated into an unstable condition. ROTATION INTERLOCK The microprocessor will be used to prevent the rotation of the aerial device to the side in which the stabilizers have not been fully deployed (short-jacked). The microprocessor will allow full and unrestricted use of the aerial, in the 180 degree area, on the side(s) where the stabilizers have been fully deployed. The system will also have a manual override, to comply with NFPA 1901. SYSTEMS THAT PERMIT THE AERIAL TO ROTATE TO THE "SHORT JACK" SIDE, WITHOUT AUTOMATICALLY STOPPING THE ROTATION AND/OR WITHOUT ACTUATION OF THE "MANUAL OVERRIDE", will NOT BE ACCEPTED. SYSTEMS THAT ONLY INCLUDE AN ALARM ARE NOT CONSIDERED AN INTERLOCK AND will NOT BE ACCEPTED. LADDER CRADLE INTERLOCK SYSTEM A ladder cradle interlock system will be provided through the microprocessor to prevent the lifting of the aerial device from the nested position until the operator places all the stabilizers in a load supporting configuration. A switch will be installed at the boom support to prevent operation of the stabilizers once the aerial has been elevated from the nested position. AERIAL TORQUE BOX/PEDESTAL The pedestal assembly will be a welded assembly made of high strength 0.25" plate. The vertical member will be a 0.375" reinforced wall cylinder with a 28.00" outside diameter and will connect the rotation bearing mounting plate to the lower substructure. The pedestal assembly will be bolted to the chassis frame with 0.88" diameter Grade 8 bolts, and will be utilized to mount the outrigger jacks and reservoir for the aerial hydraulic system. LOAD CAPACITIES The following load capacities will be established, with the stabilizers at full horizontal extension and placed in the down position, to level the truck and to relieve the weight from the tires and axles. Capacities will be based upon full 360 degree rotation with ladder extended to operational limits at 0 degrees elevation. A load chart, visible at the operator's station will be provided. The load chart will show the recommended safe load at any condition of the aerial device's elevation and extension. 35 MPH WIND CONDITIONS/WATERWAY DRY Degrees of Elevation -10 to 9 10 to 19 20 to 29 30 to 39 40 to 49 50 to 59 60 to 69 70 to 77 54751Bid #: Egress 750 750 750 750 750 750 750 750 Fly - - - - 250 250 500 750 Upper Mid - - - - 250 500 1000 1000 Lower Mid - - - 500 500 750 1000 1000 Base - - 500 500 500 1000 1000 1000 35 MPH WIND CONDITIONS/WATERWAY CHARGED Degrees of Elevation -10 to 9 10 to 19 20 to 29 30 to 39 40 to 49 50 to 59 60 to 69 70 to 77 Egress 500 500 500 500 500 500 500 500 Fly - - - - - 250 500 500 Upper Mid - - - 250 500 500 750 1000 Lower Mid - - - 250 55751Bid #: 500 750 1000 1000 Base - - 250 500 750 1000 1000 1000 Reduced loads at the tip can be redistributed in 250 lb. increments to the fly, mid, or base sections as needed. The tip capacity will be reduced to zero when flowing water with the nozzle above the waterway centerline. BOOM SUPPORT A heavy duty boom support will be provided for support of the ladder in the travel position. On the base section of the ladder, a stainless steel scuffplate will be provided where the ladder comes into contact with the boom support. 0000042 Boom Support, Rear of the Chassis Cab The boom support will be located just to the rear of the chassis cab. 0762413 Light, Boom Support, Amdor AY-LB- 12HW012, 12" LED AERIAL BOOM SUPPORT LIGHT There will be one (1) Amdor®, Model AY-LB-12HW012, 190 lumen, 12" long, white LED strip light mounted on the boom support cradle. This light will be activated when the aerial master switch is activated. 0799560 Boom Support Compartment, Not Required 0680820 Boom Panel, One, Sized to Match Opposite Side Box AERIAL BOOM PANEL There will be one boom panel provided on the base section on the left side of the aerial device while viewed from the turntable. This boom panel will be sized to match the storage box on the opposite side. The boom panel will be painted #10 white. The boom panel will be designed so no mounting bolts are in the face of the panel. This will keep the lettering surface free of holes. 0526890 Not Required, Indicator, Extension 0591645 Steps, Folding, Four, Aerial Device, Trident FOLDING STEPS One (1) set of folding steps will be provided at the tip of the ladder. An additional set of folding steps will be provided at the base of the fly section. The steps will be bright finished, non-skid with a black coating. 0688232 Rung Covers, Aerial Device AERIAL DEVICE RUNG COVERS Each rung will be covered with a secure, heavy-duty, fiberglass pultrusion that incorporates an aggressive, no-slip coating. The rung covers will be glued to each rung, and will be easily replaceable should the rung cover become damaged. The center portion of each rung cover will be black and the outside 2.00" edge at each side will be safety yellow. Under no circumstances will the rung covers be fastened to the rungs using screws or rivets. The rung covers will have a 10-year, limited warranty. 0678896 Box, Stokes/Backboard Storage, w/Cover, Base Section, In Place of Boom Panel STOKES AND BACKBOARD STORAGE BOX There will be one (1) aluminum storage box(es) provided at the base section of the aerial ladder on the right side of the aerial device while viewed from the turntable. The box will be painted to match the aerial device with the face of the box painted to match the boom sign color. The box (es) will be located in place of the aerial boom panel and have a hinged cover with butterfly latch to secure the equipment. The cover will have the same finish as the box. A divider will be provided to separate the stokes basket and the backboard. The box(es) will have no louvers. The size of the stokes basket and backboard will be determined at precon. The maximum capacity of each box will be 75 lb. 0784202 Brackets Only, Roof Ladder, Base Section, Inboard of Boom Panel, Ascendant LADDER STORAGE MOUNTING BRACKETS Mounting brackets for a single roof ladder will be provided on the left side of the aerial device while viewed from the turntable. A total of one (1) roof ladder(s) will be stored on the aerial base section. The bracket(s) will be located inboard of the boom panel at the base section and include straps to secure the ladder(s). The mounting brackets will accommodate a 16' Duo-Safety 875-A-DR roof ladder(s) to be stored individually as determined by the type of aerial device and the available space. 56751Bid #: 0601972 Lights, Turntable Walkway, P25, LED LIGHTS FOR TURNTABLE WALKWAY There will be white LED lights provided at the aerial turntable. The lights will be located to illuminate the entire walking surface of the turntable including the area around the turntable console. These lights will be activated by the aerial master switch. 0601949 Light, Turntable Console, TecNiq T- 10, LED Strip Light TURNTABLE CONSOLE LIGHTING There will be one (1), TecNiq Model T10, white LED light strip mounted in the turntable console cover to illuminate the controls located on both the upper and lower portion of the turntable control station. These lights will be activated by the aerial master switch. 0624684 Control Stations, ASL Single Axle, MUX, Color Display INFORMATION CENTER There will be an information center provided. The information center will operate in temperatures from -40 to 185 degrees Fahrenheit. The information center will employ a Linux operating system and a 7.00" (diagonal measurement) LCD display. The LCD will have a minimum 1000nits rated, color display. The LCD will be sunlight readable, true digital operation, and will have improved resolution. The LCD display will be encased in an ABS, grey plastic housing with a gray decal. There will be five (5), weather-resistant user interface switches provided. The LCD display can be changed to an available foreign language. OPERATION The information center will be designed for easy operation in everyday use. There will be a page button to cycle from one screen to the next screen in a rotating fashion. A video button will allow an NTSC signal into the information center to be displayed on the LCD. If any button is pressed while viewing a video feed, the information center will return to the vehicle information screens. There will be a menu button to provide access to maintenance, setup, and diagnostic screens. All other button labels will be specific to the information being viewed. GENERAL SCREEN DESIGN Where possible, background colors will be used to provide vehicle information At A Glance. If the information provided on a screen is within acceptable limits, a black background color will be used. If the information provided on a screen is not within acceptable limits, an amber background color will indicate a caution condition and a red background color will indicate a warning condition. Every screen in the information center will include the time (12- or 24-hour mode) and a fault alert triangle symbol. The time will be synchronized between all Command Zone color displays located on the vehicle. Once the fault alert triangle is selected, a text message will identify any items causing the audible alarm to sound. If more than one (1) audible alarm is activated, the text message for each alarm will cycle every second until the problems have been resolved. The background for the Alert Center will change to indicate the severity of the warning message. Amber will indicate a caution condition and red will indicate a warning condition. If a warning and a caution condition occur simultaneously, the red background color will be shown for all Alert Center messages. A label or symbol will be provided for each button. The label or symbol will indicate the function for each active button for each screen. If the button is not utilized on specific screens, it will remain black. Symbols will accurately depict the aerial device type the information pertains to such as rear mount ladder, rear mount platform, mid-mount ladder or mid-mount platform. PAGE SCREENS The Information center will include the following pages: The Aerial Main and Load Chart page will indicate the following information: - Rungs Aligned and Rungs Not Aligned will be indicated with respective green or red colored ladder symbols. - Ladder Elevation will be indicated via a fire apparatus vehicle with ladder symbol with the degree of elevation indicated between the vehicle and ladder. - Water Flow (if applicable) will be indicated via a water nozzle symbol and text indicating flow / time. - If applicable, breathing air levels will be indicated via an air bottle symbol and text indicating the percent (%) of air remaining. A green bar graph shown inside the bottle will indicate oxygen levels above 20%. A red bar graph will indicate oxygen levels at or below 20%. When oxygen levels are at or below 10%, the red bar graph will flash. -At A Glance color features will be utilized on this screen. A fault alert triangle symbol in the lower right portion of the screen will indicate any caution faults with a yellow background. Warning type conditions will be indicated via a red background. Conditions operating within acceptable limits will be indicated via a green background. The Aerial Reach and Hydraulic Systems page will indicate the following information: - If applicable, aerial hydraulic oil temperature will be indicated with symbol and text. - Aerial Hydraulic Oil Pressure will be indicated with a symbol and text. - The following calculations will be indicated on a representative vehicle symbol: - Aerial Device Extension length - Aerial Device Height indicating the height of the aerial device tip from the ground - Aerial Device Angle indicating the angle from the vehicle which the device is at. -At A Glance color features will be utilized on this screen. A fault alert triangle symbol in the lower right portion of the screen will indicate any caution faults with a yellow background. Warning type conditions will be indicated via a red background. Conditions operating within acceptable limits will be indicated via a green background. The Level Vehicle page will indicate the following information: - The grade of the vehicle will be indicated via a fire apparatus vehicle symbol with the degree of grade shown in text format. The symbol will tilt dependent on the vehicle grade. - The slope of the vehicle will be indicated via a fire apparatus vehicle symbol with the degree of slope shown in text format. The symbol will tilt dependent on the vehicle slope. - Outriggers status will be indicated via a colored symbol for each outrigger present. Each outrigger status will be defined as one of the following: - Outrigger stowed indicated with a silver pan located close to the vehicle - Outrigger fully extended indicated with a fully deployed green outrigger - Outrigger short-jacked indicated by a yellow outrigger partially deployed - Outrigger not set indicated by a red outrigger that is not set on the ground 57751Bid #: - A bedding assist alert will indicate that the aerial device is being aligned by the Command Zone system as the operator lowers the aerial device into the cradle with the joystick. -At A Glance color features will be utilized on this screen. A fault alert triangle symbol in the lower right portion of the screen will indicate any caution faults with a yellow background. Warning type conditions will be indicated via a red background. Conditions operating within acceptable limits will be indicated via a green background. The aerial operation envelope page will indicate the following: - A top view of the aerial operating envelope - A side view of the aerial operating envelope MENU SCREENS The following screens will be available through the Menu button: The View System Information screen will display aerial device hours, aerial PTO hours, ladder aligned for stowing, aerial rotation angle, total water flow (if applicable), and aerial waterway valve status (if applicable). The Set Display Brightness screen will allow brightness increase and decrease and include a default setting button. The Configure Video Mode screen will allow setting of video contrast, video color and video tint. The Set Startup screen allows setting of the screen that will be active at vehicle power-up. The Set Date and Time screen has a 12- or 24-hour format, and allows setting of the time and date. The View Active Alarms screen shows a list of all active alarms including the date and time of each alarm occurrence, and shows all alarms that are silenced. The System Diagnostics screen allows the user to view system status for each module and its respective inputs and outputs. Viewable data will include the module type and ID number; the module version; and module diagnostics information including input or output number, the circuit number connected to that input or output, the circuit name (item connected to the circuit), status of the input or output, and other module diagnostic information. Aerial Calibrations screen indicates items that may be calibrated by the user and instructions to follow for proper calibration of the aerial device. Button functions and button labels may change with each screen. LOWER STABILIZER CONTROL STATIONS A lower control station will be located on each side of the rear wall of the apparatus in an easily accessible area. The controls and indication labels will be illuminated for nighttime operation. The following items will be furnished at the lower control station and will be clearly identified and conveniently located for ease of operation and viewing: - Level assist switch - Override switch to override interlocks - Emergency stop - Emergency hydraulic power unit switch The stabilizer controls will include the following: - Leveling assist toggle switch - Left and right side stabilizer beam in/out switches - Left and right side stabilizer beam up/down switches - Rear stabilizer up/down switch TURNTABLE CONTROL STATION There will be one (1) device control station located on the left side of the turntable so the operator may easily observe the ladder while operating the controls. All elevation, extension and rotation controls will operate from this location. The controls will permit the operator to regulate the speed of the aerial functions, within the safe limits, as determined by the manufacturer and NFPA standards. Each control will be equipped with a positive lock to hold the control in a neutral position preventing accidental activation. In addition to the neutral lock, a console cover will be provided at the turntable control station. The controls will be so designed to allow the turntable control station to immediately override the tip controls, if equipped, even if the ladder is being operated by the tip controls. The following items will also be provided at the turntable control station, clearly identified and illuminated for nighttime operation and conveniently located for ease of operation and viewing: - Intercom controls - Tip tracking light switch - Emergency stop switch - Emergency power unit switch - Operator's load chart - Two (2) position switch for selecting aerial operational speed - Ladder illumination switch (if equipped) - Aerial monitor switches (if equipped) HIGH IDLE The high idle will be controlled by the microprocessor. The microprocessor will automatically adjust the engine rpm, to compensate for the amount of load placed upon the system. The system will include a safety device that allows activation of the high idle, only when the parking brake is set and the transmission is placed in neutral. 58751Bid #: 0624682 Stabilizers, One Set, Ascendant Single Axle STABILIZERS The vehicle will come equipped with an out and down stabilization system. The system will consist of two (2) hydraulically operated out and down style stabilizers mounted above the frame and a rear stabilizer jack that is attached directly to the center rear of the torque box. The stabilizers will have a maximum spread of 18' from the centerline of the footpads when fully extended. The internal tubes will be 8.00" x 10.00" with 1/2" thick top and bottom plates and 3/8" thick sides of 130,000 psi minimum yield strength steel and will be extended out by hydraulic cylinders. The cylinders will have pilot-operated check valves with thermal relief. This will insure that the beams will be in the stowed during travel. The external tubes will be 9-3/4" x 11-3/4" with 3/8" wall thickness. The internal jack tubes will slide on permanently attached wear pads. The extension cylinders will be totally enclosed within the extension beams. The horizontal extension cylinders will be of the trombone type to eliminate wear and potential failure of hydraulic hoses. The stabilizers will have a tip over safety margin of 1 1/2 times its rated load in any position the aerial device can be placed as outlined in the current edition of NFPA 1901. The aerial will be able to sustain a 1 1/3 to 1 rated load on a 5 degree slope downward in the position most likely to cause overturning. The maximum ground slope the apparatus can be set up on is 12 percent. On the 12 percent slope, the apparatus can be leveled within a 6 percent operating range with the apparatus cab facing uphill. The cylinders will be supplied with dual pilot operated check valves on each stabilizer cylinder to hold the cylinder in the stowed or working position should a charged line be severed at any point in the hydraulic system. Stabilizers will contain safety lock valves and will require no mechanical pins to assure there will be no "leak down" of stabilizer legs. Each stabilizer leg will have attached to the end of the leg a 16 gauge polished stainless steel shield. The stainless steel shield will be a maximum 13.00" wide to allow the extension of the stabilizer between parked cars. This plate will serve as a protective guard and a mounting surface for warning lights. The top, forward, and rear edges will be flanged back for added strength. The stabilizer cylinders will be sized to maximize ground penetration. The lift cylinders will be mounted on the end of the stabilizer tube and will have the following dimensions: 4.00" bore 3.50" rod 23.38" stroke The stabilizer extension cylinders will have the following dimensions 1.75" bore 1.25" rod 64.00" stroke The rear stabilizer will have the following dimensions: 4.50" bore 4.00" rod 29.00" stroke Each stabilizer that can be extended from the body will be supplied with a red warning light as outlined in the current edition of NFPA. The stabilizers will be connected to a warning light in the cab to warn the operator if the stabilizers are deployed. The ground contact area for each stabilizer will be a 12.00" diameter circular stainless steel disc without the auxiliary pads and 24.00" x 24.00" with lightweight composite material pads deployed. The ground pressure will not exceed 75 psi when the apparatus is fully loaded and the aerial device is carrying its rated capacity in every position. This will be accomplished with the stabilizer pads deployed, as outlined in the current edition of NFPA 1901. There will be one (1) pad located on each side of the apparatus in front of the stabilizers. The auxiliary jack pad for the rear stabilizer will be integral to the stabilizer foot pad. STABILIZER CONTROLS One (1) electric solenoid valve will control the stabilizers. The control switches will be located one (1) each side at the rear of the apparatus so the operator may observe the stabilizers during deployment. The stabilizer controls will include the following: - Leveling assist toggle switch: The outrigger control system will incorporate a computerized self leveling system in addition to the standard outrigger controls. The operator will have the option to manually or automatically level the truck. The computerized system will ensure full outrigger extension, proper jack penetration, and will level the vehicle within 1/2 a degree of level for safe operation of the aerial device. - One (1) electric toggle switch for the engaging the emergency power unit. - Two (2) fully extended beams green indicator lights: these lights will be illuminated when each of the respective stabilizer beams are fully extended. - Three (3) firm on ground green indicator lights: each light will be illuminated when its respective stabilizer shoe is in the load supporting condition. Each toggle switch will activate the engine fast idle automatically. Manual override will be supplied for each stabilizer control valve. A "Stabilizers Not Stowed" indicator will be provided in the driver's compartment. It will illuminate automatically whenever the stabilizers are not fully stowed to prevent damage to the apparatus if moved. The stabilizer system will also be wired to the "Do Not Move Indicator Light", which will flash whenever the apparatus parking brake is not fully engaged and the stabilizers are not fully stowed. 0782113 Door, Stabilizer Control Box, Ascendant Single Axle MUX, Smooth Aluminum STABILIZER CONTROL BOX ALUMINUM DOOR A vertically hinged smooth aluminum door will be provided over each stabilizer control box. The door will be hinged outboard. 0615058 Stabilizer Placement, Cameras w/Command Zone Color Display, 1 Set STABILIZER PLACEMENT There will be two (2) cameras provided and installed on the body, one (1) directly above each stabilizer. The cameras will be activated with a switch in the cab and will provide a picture to specify the fully extended stabilizer position allowing the driver the ability to position the vehicle with the proper clearance for stabilizer deployment. 59751Bid #: 0624678 Hydraulic System, Ascendant Single Axle HYDRAULIC SYSTEM All hose assemblies will be assembled and crimped by the hose manufacturers certified technician. All manufacturing employees responsible for the installation of hydraulic components will be properly trained. Training will include: proper handling, installation, torque requirements, cleanliness and quality control procedures for hydraulic components. Hoses used in the aerial hydraulic system will be of a premium quality hose with a high abrasion resistant cover. All pressure hoses will have a working pressure of 4000 psi and a burst pressure rating of 16,000 psi. All hydraulic fittings and tubing will be plated to minimize corrosion. The fitting will use an O-ring seal where possible to minimize hydraulic leaks. An interlock will be provided that prevents activation of the hydraulic pump until the transmission is placed in neutral and the parking brake is set as outlined in the current NFPA 1901 standard. The system will meet the performance requirement of the current NFPA 1901 standard, which requires adequate cooling less than 2.5 hours of operations. All hydraulic components that are non-sealing whose failure could result in the movement of the aerial will comply with current NFPA 1901 standards and have burst strength of 4:1. Dynamic sealing components whose failure could cause aerial movement will have a margin of 2:1 on maximum operating pressure per the current NFPA 1901 standard. All hydraulic hoses, tubes, and connections will have a minimum burst strength of 4:1 per the current NFPA 1901 standard. A hydraulic oil sight gauge will be supplied at the rear of the unit for easy fluid level verification. A chassis mounted positive displacement piston pump for consistent pressure and rapid responses will supply hydraulic power for all aerial operations. The positive displacement pump will provide 3,150psi. The hydraulic pump will be solely dedicated to aerial operations. Each aerial will be evaluated as to the region and climate where it will be used to determine the optimum viscosity and proper oil grade. Oil viscosity will be based on an optimum range of 80 to 1000 SUS during normal aerial use. Before shipment of the unit, an oil sample will be taken and analyzed to confirm the oil is within the allowable ISO grade tolerance. The aerial hydraulic system will have a minimum oil cleanliness level of ISO 18/15/13 based on the ISO 4406:1999 cleanliness standard. Each customer will receive a certificate of actual cleanliness test results and an explanation of the rating system. Each aerial will include an oil sample port, identified with a yellow dust cap and a label, for subsequent customer testing. Ball valves will be provided in the hydraulic suction lines to permit component servicing without draining the oil reservoir. The aerial will incorporate the use of trombone steel tubes inside the stabilizer beams to eliminate hydraulic hose wear and leaks. Hydraulic power to the ladder will be transferred from the pedestal by a hydraulic swivel. The system hydraulic pressure will be displayed on the turntable display. The hydraulic system will be additionally protected from excessive pressure by a secondary pressure relief valve set at 3,150 psi. In the event the main hydraulic pump compensator malfunctions, the secondary relief will prevent system damage. HYDRAULIC CYLINDERS All cylinders used on the aerial device will be produced by a manufacturer that specializes in the manufacture of hydraulic cylinders. Each cylinder will include integral safety holding cartridges. Each cylinder will be designed to a minimum safety factor of 4:1 to failure. All safety holding cartridges will be installed at the cylinder manufacturer, in a controlled clean environment to avoid possible contamination and or failure. POWER TAKEOFF/HYDRAULIC PUMP The apparatus will be equipped with a power takeoff driven by the chassis transmission and actuated by an electric shift, located inside the cab. The power takeoff which drives the hydraulic pump will meet all the requirements for the aerial unit operations. A green indicator light will be installed on the cab instrument panel to notify the operator that the power takeoff is engaged. An interlock will be provided that allows operation of the aerial power takeoff shift only after the chassis spring brake has been set and the chassis transmission has either been placed in the neutral position or drive position after the driveline has been disengaged from the rear axle. The hydraulic system will be supplied by a variable displacement load and pressure compensating piston pump. The pump will meet the demands of all three simultaneous aerial functions. The pump will provide proper flow for single aerial function with the engine at idle speed. A switch will be provided on the control console to increase the engine speed for multiple function operation. EMERGENCY PUMP The hydraulic system will be designed with an auxiliary power unit meeting the guidelines of the current NFPA 1901 standard. The aerial will be equipped with an emergency hydraulic pump, electrically driven from the truck batteries. The pump will be capable of running for 30 minutes for limited aerial functions to stow the unit in case of a main pump or truck system failure. A momentary switch will be located at the stabilizer and aerial control locations to activate the emergency pump. AERIAL CONTROL VALVE The aerial hydraulic control valve will be designed with special spool flows, limiting the oil flow for the designed function speed. The valve will be electrically controlled and be located in the control console with the handles oriented downward for manual operation. The activation handles will be spaced a minimum of 3.50" for ease of operation. The valve spools will be designed to bleed off downstream pressure, in the neutral position and allow proper sealing of any cylinder holding cartridge. OIL RESERVOIR The oil reservoir will have a minimum capacity of 20 gallons. The oil fill location will be easily accessible and be labeled "Hydraulic Oil Only" and also indicate the grade of oil that is installed in the reservoir. The fill will have a desiccant breather filter with a water capacity of 4 fluid ounces and a 5 micron rating. Two suction ports will be provided, one for the main hydraulic pump and one for the emergency pump. The main suction will be slightly elevated off the bottom of the reservoir. The emergency suction port will be closer to the bottom of the reservoir to provide some reserve oil for emergency operation. 60751Bid #: A temperature sending unit in the reservoir will provide indication of the oil temperature on an electronic display. The hydraulic oil reservoir will be labeled per the current edition of NFPA 1901 standard. RETURN FILTER The low pressure oil filter will be integrated with the hydraulic manifold and designed to prevent oil loss during filter change. The system will incorporate the following filter to provide dependable service: return filter: beta 200 at 6 micron 0615180 Swivels, w/Encoder, ASL Single Axle, (28 Collector Rings) HYDRAULIC SWIVEL The aerial ladder will be equipped with a six (6) port, high pressure hydraulic swivel which will connect the hydraulic lines from the hydraulic pump and reservoir through the rotation point to the aerial control bank. The hydraulic swivel will allow for 360 degree continuous rotation of the aerial. ELECTRIC SWIVEL The ladder will be equipped with an electric swivel to allow 360 degrees rotation of the aerial while connecting all electrical circuits through the rotation point. A minimum of 28 collector rings will be provided that are capable of supplying 20 amp continuous service. All collector rings will be enclosed and protected with desiccant plugs against condensation and corrosion. No oil or silicone will be used. WATER SWIVEL Water will be transferred to the aerial waterway by means of a 5.00" internal diameter waterway through the swivel, permitting 360 degree continuous rotation. 13-BIT ABSOLUTE ENCODER The aerial ladder will be equipped with a 13-Bit Absolute Encoder, CAN-based, which provides 8192 counts per shaft turn for position and direction reference. The 13-Bit Absolute Encoder will provide a unique binary word to reference each position and direction for all 360 degrees of rotation. If the power is interrupted for any reason, the 13-Bit Absolute Encoder will allow power to be returned to the system without having to re-zero the settings. The 13-Bit Absolute Encoder will be an integral part of a micro-processor based control system. 0624676 Electrical System, ASL Single Axle, MUX ELECTRICAL SYSTEM The aerial device will utilize a microprocessor-based control system. The system will consist of the following components: Control System Modules Each of the control system modules will be configured as follows: Sealed to a NEMA 4X rating Operating range from -40 degrees F to 156 degrees F (-40 degrees C to 70 degrees C) Communicate using J1939 data link Two (2) diagnostic LED lights One (1) green light that illuminates when module has power (B+) and ground One (1) red light that flashes to indicate the module is capable of communicating via the data link Up to 16 diagnostic LEDs on each module Ground matrix identification system The following control system modules will be used: Control Module Main controller for the system USB connection allows for computer diagnostics Power Module Built-in fault sensing Eight (8) digital outputs Pulse width modulating (PWM) capable 10A continuous per output Circuit protection based on actual current draw (not affected by heat) Current Control Module Built-in fault sensing Three (3) analog inputs Eight (8) digital outputs Pulse width modulating (PWM) capable 3A continuous per output Closed Loop System Circuit protection based on actual current draw (not affected by heat) Input Module 16 software selectable (digital or analog) inputs Output Module 16 digital outputs Input/Output Module Eight (8) software selectable (digital or analog) inputs Eight (8) digital outputs 61751Bid #: 0607850 Lights, FRC SRA110-07A* LED Spot, Trk & Tip, 6lts (PAL/HAL) SPOTLIGHTS There will be six (6) Fire Research Model SRA110-07A*, 7,000 lumens 12 volt DC LED lights with polished fixed mounts furnished per the following: One (1) will be mounted on the driver's side of the base section of the ladder One (1) will be mounted on the passenger's side of the base section of the ladder One (1) will be mounted high on the driver's side tip of aerial One (1) will be mounted high on the passenger's side tip of aerial One (1) will be mounted low on the driver's side tip of the aerial One (1) will be mounted low on the passenger's side tip of the aerial The painted parts of this light assembly to be white. Power to the "tracking lights" will be controlled by an on/off switch at the turntable control operator's position. The lights at the tip will be controlled by platform/tip and turntable. 0653677 Lighting, Rung, LED, TecNiq, 4 Section, Base, Lower/Upper Mid, Fly LIGHTING ON AERIAL LADDER There will be TecNiq, Model D02 LED rung lighting provided on both sides of the aerial ladder base, lower and upper mid, and fly sections. The lighting will be located adjacent to the ladder rungs along the lower rail of the ladder sections and will run the length of the ladder section. The color of the sections will be: The base section of the ladder to be blue. The lower mid section of the ladder to be blue. The upper mid section of the ladder to be blue. The fly section of the ladder to be blue and the last three (3) rungs to be red. The LED rung lighting will be activated when a switch at the turntable operator's panel is activated through the master battery switch. The lights may be load managed when the parking brake is applied. 0540737 Lights, Stabilizer Warn (1) Set, Wln M6*C LED, Clear Lens STABILIZER WARNING LIGHTS There will be two (2) Whelen®, Model M6*, LED flashing warning lights with clear lenses and Whelen, Model M6FC, chrome flanges installed on the stabilizer cover panels, one (1) each side. The LED lights will be red. These warning lights will be activated by the same switch as the side warning lights. 0617469 Lights, Wln T0R00FRR LED 2", Stabilizer Beam (1) Set, Ascendant STABILIZER BEAM WARNING LIGHTS There will be two (2) Whelen®, Model T0R00FRR, 2.00" round red LED flashing lights mounted on each out and down stabilizer, one (1) facing forward and one (1) facing rearward. The lights will be recessed in the horizontal beam of the stabilizer. These warning lights will be activated with the aerial master switch. 0768550 Lights, Stabilizer Scene, Amdor AY- LB-12HW012, 12", 3lts LED, Ascendant Single STABILIZER SCENE LIGHTS There will be three (3) Amdor, Model AY-LB-12HW012, 190 lumens, 12.00" long, white LED strip lights installed to illuminate the area around the aerial stabilizers, one (1) light per stabilizer. The lights will be activated by the aerial master switch. 0783034 DC Power To Aerial Tip, 14.0 Amps @ 12 Volt DC, ASL DC POWER CABLE to TIP There will be a cable installed in the aerial device to provide 14.00 amps @ 12 volts DC to the tip of the aerial device. 0594648 Intercom, 2-Way Fire Research ICA900 Hands Free 2-WAY AERIAL COMMUNICATION SYSTEM There will be a Fire Research model ICA900-112 two-way intercom system provided. The control module will be located on the turntable operator console, provided there is room, and have an LED volume display and push-button volume control. A hands free module will be located at the aerial tip or platform and constantly transmit to the other module unless the control module push-to-talk button is pressed. Each intercom unit will be weatherproof. 0540895 Not Required, Breathing Air to Tip, Aerial Ladder 0024742 Not Required, Mask, Breathing Air To Tip 0610887 Aerial Pedestal, Ascendant Single Axle AERIAL PEDESTAL The aerial pedestal will accommodate the height of the cab. 0604457 Lifting Eye Assembly, Rope Rescue Attachment, ASL LIFTING EYE ASSEMBLY - ROPE RESCUE ATTACHMENT A lifting eye assembly will be provided that is designed to evenly distribute load at the tip of the aerial. The lift eye assembly is retained by two (2) locking pins, one (1) at each end outboard side of the egress. Leveling is maintained by the lifting eye assembly rotating within the egress mounting. 62751Bid #: 0530828 Turntable Access, Chains AERIAL TURNTABLE CHAIN A chain will be installed at the aerial turntable. 0624672 Waterway, High Flow, 1500 GPM, ASL WATER SYSTEM A waterway system will be provided consisting of the following components and features: A 5.00" pipe will be connected to the water supply on one end and to a 5.00" internal diameter water swivel at the rotation point of the turntable. The water swivel will permit 360 degree continuous rotation of the aerial device. The 5.00" waterway swivel is to be routed through the rotation point up to the heel pin swivel. The heel pin swivel will allow the water to flow to the ladder pipe while elevating the aerial ladder from -10 degrees to 77 degrees. The heel pivot pin is not integral with the waterway swivel at any point. The design of the waterway will allow complete servicing of the waterway swivel without disturbing the heel pivot pin. The integral telescopic water system will consist of a 4.50" diameter tube in the base section, a 4.00" diameter tube in the mid-section and a 3.50" diameter tube in the fly section. The telescopic waterway will be constructed of anodized aluminum pipe. The aerial will be capable of discharging up to 1000 gpm at 100 psi parallel to the ladder and 90 degrees to each side of center while maintaining the 500lb tip load. The aerial will be capable of discharging between 1001 and up to 1500 gallons per minute at 100 psi parallel to the ladder and 40 degrees to each side of center while maintaining the 500lb tip load. When the aerial device is positioned at -10 to 0 degrees of elevation, the master stream will be capable of flow up to 30 degrees above horizontal. An adjustable pressure relief valve will be furnished to protect the aerial waterway from a pressure surge. A 1.50" drain valve will be located at the lowest point of the waterway system. WATERWAY SEALS The waterway seals will be of type-B PolyPak design, composed of nitroxile seal and a nitrile wiper, which together offer maximum stability and extrusion resistance on the waterway. The seal will be capable of withstanding pressures up to 2000 psi, temperatures in excess of 250 degrees Fahrenheit and have resistance to all foam generating solutions. The seals will be internally lubricated. The waterway seals will have automatic centering guides constructed of synthetic thermalpolymer. The guides will provide positive centering of the extendible sections within each other and the base section to insure longer service life and smoother operation. 0632855 Monitor, Akron 3480 StreamMaster II Electric w/Extended Vertical Travel AERIAL MONITOR An Akron Model 3480 monitor with stow and deploy will be provided at the tip with a Akron 1250 gpm Model 1578. This monitor will allow for an additional 30 degrees of travel above horizontal at the aerial tip. The monitor's functions will be controlled electrically from two (2) separate locations. One (1) control will be located at the control console and the other at the ladder tip. There will be a courtesy light at the tip of the aerial to illuminate the controls. If the aerial has a quick-lock waterway, a limit switch will be provided to disable the extended vertical travel when the monitor is locked to the lower ladder section. 0010758 Flow Meter, Waterway, PAL, 110' Ascendant, MUX AERIAL WATERWAY FLOW METER Waterway flow, including total water flowed, will be monitored by the microprocessor. An LCD display will be located at the turntable control station. 0624671 Inlet, 5.00" w/5.00" Aluminum, Plumbing at Rear, Ascendant Single Axle REAR INLET A 5.00" NST inlet to the aerial waterway will be provided at the rear of the apparatus. The inlet will have 5.00" aluminum plumbing. It will be furnished with a 5.00" chrome plated adapter and a 5.00" chrome plated, long handle cap. 0673128 Quick-Lock Waterway Locking System, 100' HDL/MDL, 105' HDL, ASL WATERWAY LOCKING SYSTEM The aerial ladder waterway monitor will be capable of being positioned at either the fly section or at the next lower section of the ladder. The monitor location will be changeable by the use of a single handle, located at the side of the ladder. The handle, attached to a cam bracket, will simply be moved forward to lock the monitor at the fly section and back to lock it to the previous section. There will be no pins to remove and reinstall. The monitor will be operational at all times, regardless of its position, without connecting or disconnecting electrical lines. 0047897 Tools, Aerial TOOLS The following tools will be provided for retorquing of all specified bolts as recommended by the manufacturer: Torque Wrench All Required Extensions, Sockets and Adapters 4-to-1 Multiplier 63751Bid #: 0559494 Manuals and Training, 3 Consecutive Days, Ascendant Ladder, PAL MANUALS Two (2) operator maintenance manuals and two (2) wiring diagrams pertaining to the aerial device will be provided with the apparatus at time of pick-up. INITIAL INSTRUCTION On initial delivery of the fire apparatus, the contractor will supply a qualified representative to demonstrate the apparatus and provide initial instruction to the fire department regarding the operation, care, and maintenance of the apparatus for a period of three (3) consecutive days. 0007150 Bag of Nuts and Bolts LOOSE EQUIPMENT The following equipment will be furnished with the completed unit: - One (1) bag of chrome, stainless steel, or cadmium plated screws, nuts, bolts and washers, as used in the construction of the unit. 0602497 NFPA Required Loose Equipment, Quint, NFPA 2016, Provided by Fire Department NFPA REQUIRED LOOSE EQUIPMENT PROVIDED BY FIRE DEPARTMENT The following loose equipment as outlined in NFPA 1901, 2016 edition, section 9.9.3 and 9.9.4 will be provided by the fire department. 800 ft (240 m) of 2.50" (65 mm) or larger fire hose, in any combination. 400 ft (120 m) of 1.50" (38 mm), 1.75" (45 mm), or 2.00" (52 mm) fire hose, in any combination. One (1) handline nozzle, 200 gpm (750 L/min) minimum. Two (2) handline nozzles, 95 gpm (360 L/min) minimum. One (1) playpipe with shutoff and 1.00" (25 mm), 1.125" (29 mm), and 1.25" (32 mm) tips. One (1) SCBA complying with NFPA 1981 for each assigned seating position, but not fewer than four (4), mounted in brackets fastened to the apparatus or stored in containers supplied by the SCBA manufacturer. One (1) spare SCBA cylinder for each SCBA carried, each mounted in a bracket fastened to the apparatus or stored in a specially designed storage space(s). One (1) first aid kit. Four (4) salvage covers, each a minimum size of 12 ft × 14 ft (3.6 m × 5.5 m). Four (4) combination spanner wrenches. Two (2) hydrant wrenches. One (1) double female 2.50" (65 mm) adapter with National Hose threads. One (1) double male 2.50" (65 mm) adapter with National Hose threads. One (1) rubber mallet, for use on suction hose connections. Four (4) ladder belts meeting the requirements of NFPA 1983. One (1) 150 ft (45 m) light-use life safety rope meeting the requirements of NFPA 1983. One (1) 150 ft (45 m) general-use life safety rope meeting the requirements of NFPA 1983. One (1) traffic vest for each seating position, each vest to comply with ANSI/ISEA 207,Standard for High Visibility Public Safety Vests, and have a five-point breakaway feature that includes two (2) at the shoulders, two (2) at the sides, and one (1) at the front. Five (5) fluorescent orange traffic cones not less than 28.00" (711 mm) in height, each equipped with a 6.00" (152 mm) retro-reflective white band no more than 4.00" (152 mm) from the top of the cone, and an additional 4.00" (102 mm) retro-reflective white band 2.00" (51 mm) below the 6.00" (152 mm) band. Five (5) illuminated warning devices such as highway flares, unless the five (5) fluorescent orange traffic cones have illuminating capabilities. One (1) automatic external defibrillator (AED). If the supply hose carried does not use sexless couplings, an additional double female adapter and double male adapter, sized to fit the supply hose carried, will be carried mounted in brackets fastened to the apparatus. If none of the pump intakes are valved, a hose appliance that is equipped with one or more gated intakes with female swivel connection(s) compatible with the supply hose used on one side and a swivel connection with pump intake threads on the other side will be carried. Any intake connection larger than 3.00" (75 mm) will include a pressure relief device that meets the requirements of 16.6.6. If the apparatus does not have a 2.50" National Hose (NH) intake, an adapter from 2.50" NH female to a pump intake will be carried, mounted in a bracket fastened to the apparatus if not already mounted directly to the intake. If the supply hose carried has other than 2.50" National Hose (NH) threads, adapters will be carried to allow feeding the supply hose from a 2.50" NH thread male discharge and to allow the hose to connect to a 2.50" NH female intake, mounted in brackets fastened to the apparatus if not already mounted directly to the discharge or intake. 0602397 Soft Suction Hose, Provided by Fire Department, Quint NFPA 2016 Classification SOFT SUCTION HOSE PROVIDED BY FIRE DEPARTMENT NFPA 1901, 2016 edition, section 9.8.2.1 requires a minimum of 20' of suction hose or 15' of supply hose will be carried. Hose is not on the apparatus as manufactured. The fire department will provide suction or supply hose. 0027023 No Strainer Required 0602534 Extinguisher, Dry Chemical, Quint NFPA 2016, Provided by Fire Department DRY CHEMICAL EXTINGUISHER PROVIDED BY FIRE DEPARTMENT NFPA 1901, 2016 edition, section 9.9.4 requires one (1) approved dry chemical portable fire extinguisher with a minimum 80-B:C rating mounted in a bracket fastened to the apparatus. The extinguisher is not on the apparatus as manufactured. The fire department will provide and mount the extinguisher. 64751Bid #: 0602352 Extinguisher, 2.5 Gal. Pressurized Water, Quint, NFPA 2016,Provided by Fire Dept WATER EXTINGUISHER PROVIDED BY FIRE DEPARTMENT NFPA 1901, 2016 edition, section 9.9.4 requires one (1) 2.5 gallon or larger water extinguisher mounted in a bracket fastened to the apparatus. The extinguisher is not on the apparatus as manufactured. The fire department will provide and mount the extinguisher. 0007482 Not Required, Crowbars 0007484 Not Required, Claw Tools 0602883 Axe, Flathead, Quint NFPA 2016, Provided by Fire Department FLATHEAD AXE PROVIDED BY FIRE DEPARTMENT NFPA 1901, 2016 edition, Section 9.9.4 requires one (1) flathead axe mounted in a bracket fastened to the apparatus. The axe is not on the apparatus as manufactured. The fire department will provide and mount the axe. 0602670 Axe, Pickhead, Quint NFPA 2016, Provided by Fire Department PICKHEAD AXE PROVIDED BY FIRE DEPARTMENT NFPA 1901, 2016 edition, Section 9.9.4 requires one (1) pickhead axe mounted in a bracket fastened to the apparatus. The axe is not on the apparatus as manufactured. The fire department will provide and mount the axe. 0007494 Not Required, Sledgehammers 65751Bid #: 0559573 Paint, Single Color, Custom PAINT - BODY PAINTED TO MATCH CAB The exterior custom cab and body painting procedure will consist of a seven (7) step finishing process as follows: Manual Surface Preparation - All exposed metal surfaces on the custom cab and body will be thoroughly cleaned and prepared for painting. Imperfections on the exterior surfaces will be removed and sanded to a smooth finish. Exterior seams will be sealed before painting. Exterior surfaces that will not be painted include; chrome plating, polished stainless steel, anodized aluminum and bright aluminum treadplate. Chemical Cleaning and Pretreatment - All surfaces will be chemically cleaned to remove dirt, oil, grease, and metal oxides to ensure the subsequent coatings bond well. The aluminum surfaces will be properly cleaned and treated using a high pressure, high temperature 4 step Acid Etch process. The steel and stainless surfaces will be properly cleaned and treated using a high temperature 3 step process specifically designed for steel or stainless. The chemical treatment converts the metal surface to a passive condition to help prevent corrosion. A final pure water rinse will be applied to all metal surfaces. Surfacer Primer - The Surfacer Primer will be applied to a chemically treated metal surface to provide a strong corrosion protective basecoat. A minimum thickness of 2 mils of Surfacer Primer is applied to surfaces that require a Critical aesthetic finish. The Surfacer Primer is a two- component high solids urethane that has excellent sanding properties and an extra smooth finish when sanded. Finish Sanding - The Surfacer Primer will be sanded with a fine grit abrasive to achieve an ultra- smooth finish. This sanding process is critical to produce the smooth mirror like finish in the topcoat. Sealer Primer - The Sealer Primer is applied prior to the Basecoat in all areas that have not been previously primed with the Surfacer Primer. The Sealer Primer is a two-component high solids urethane that goes on smooth and provides excellent gloss hold out when topcoated. Basecoat Paint - Two coats of a high performance, two component high solids polyurethane basecoat will be applied. The Basecoat will be applied to a thickness that will achieve the proper color match. The Basecoat will be used in conjunction with a urethane clear coat to provide protection from the environment. Clear Coat - Two (2) coats of Clear Coat will be applied over the Basecoat color. The Clear Coat is a two-component high solids urethane that provides superior gloss and durability to the exterior surfaces. Lap style and roll-up doors will be Clear Coated to match the body. Paint warranty for the roll-up doors will be provided by the roll-up door manufacture. Each batch of basecoat color is checked for a proper match before painting of the cab and the body. After the cab and body are painted, the color is verified again to make sure that it matches the color standard. Electronic color measuring equipment is used to compare the color sample to the color standard entered into the computer. Color specifications are used to determine the color match. A Delta E reading is used to determine a good color match within each family color. All removable items such as brackets, compartment doors, door hinges, and trim will be removed and separately if required, to ensure paint behind all mounted items. Body assemblies that cannot be finish painted after assembly will be finish painted before assembly. Pierce Manufacturing paint finish quality levels for critical areas of the apparatus (cab front and sides, body sides and doors, and boom lettering panels) meet or exceed the Cadillac/General Motors GMW15777 global paint requirements. Orange peel levels meet or exceed the #6 A.C.T.standard in critical areas. These requirements are met in order for the exterior paint finish to be considered acceptable. The Pierce Manufacturing written paint standards will be available upon request. The cab and the body will be painted #90 red. PAINT - ENVIRONMENTAL IMPACT Contractor will meet or exceed all current State regulations concerning paint operations. Pollution control will include measures to protect the atmosphere, water and soil. Controls will include the following conditions: Topcoats and primers will be chrome and lead free. Metal treatment chemicals will be chrome free. The wastewater generated in the metal treatment process will be treated on-site to remove any other heavy metals. Particulate emission collection from sanding operations will have a 99.99% efficiency factor. Particulate emissions from painting operations will be collected by a dry filter or water wash process. If the dry filter is used, it will have an efficiency rating of 98.00%. Water wash systems will be 99.97% efficient Water from water wash booths will be reused. Solids will be removed on a continual basis to keep the water clean. Paint wastes are disposed of in an environmentally safe manner. Empty metal paint containers will be to recover the metal. Solvents used in clean-up operations will be recycled on-site or sent off-site for distillation and returned for reuse. Additionally, the finished apparatus will not be manufactured with or contain products that have ozone depleting substances. Contractor will, upon demand, present evidence that the manufacturing facility meets the above conditions and that it is in compliance with his State EPA rules and regulations. 66751Bid #: 0646901 Paint Chassis Frame Assy, With Liner, E-Coat, Standard PAINT CHASSIS FRAME ASSEMBLY The chassis frame assembly will be finished with primer and gloss paint to match the lower job color before the installation of the cab and body, and before installation of the engine and transmission assembly, air brake lines, electrical wire harnesses, etc. Components that are included with the chassis frame assembly that will be painted are: Frame rails Frame liners Cross members Axles Suspensions Steering gear Battery boxes Bumper extension weldment Frame extensions Body mounting angles Rear Body support substructure (front and rear) Pump house substructure Air tanks Steel fuel tank Castings Individual piece parts used in chassis and body assembly Components treated with epoxy E-coat protection prior to paint: Two (2) C-channel frame rails Two (2) frame liners The E-coat process will meet the technical properties shown. 0693797 No Paint Required, Aluminum Front Wheels 0687653 Paint, Rear Wheels, Single Axle, Alum-Stl PAINT, REAR WHEELS All wheel surfaces, inside and outside of inboard steel wheels only, will be provided with powder coat paint #101 black. 0594533 Paint, Grille, Mesh Only, AXT/Vel/Imp/DCF/SFR/Enf PAINT GRILLE MESH The mesh on the front grille will be painted BLACK. 0007230 Compartment, Painted, Spatter Gray COMPARTMENT INTERIOR PAINT The interior of all compartments will be painted with a gray spatter finish for ease of cleaning and to make it easier to touch up scratches and nicks. 0792617 Aerial Ladder Paint, ASL-Single Axle, E-Coat AERIAL DEVICE PAINT COLOR The aerial device paint procedure will consist of a six (6) step finishing process as follows: 1. Manual Surface Preparation - All exposed metal surfaces on the aerial device structural components above the rotation point will be thoroughly cleaned and mechanically shot-blasted to remove metal impurities and prepare the aerial for painting. 2. Primer/Surfacer Coats - A two (2) component urethane primer/surfacer will be applied to the mechanically shot-blasted metal surfaces to provide a strong corrosion protective base coat and to smooth out the surface. All seams will be caulked with a two (2) component epoxy caulk before painting. 3. Hand Sanding - The primer/surfacer coat of the outer surfaces of the hand rails and base rails will be lightly sanded to a smooth finish. 4. Sealer Primer Coat - A two (2) component sealer primer coat will be applied over the sanded primer. 5. Topcoat Paint - Urethane base coat will be applied to opacity for correct color matching. 6. Clearcoat - Two (2) coats of an automotive grade two (2) component urethane will be applied. Surfaces that will not be painted include all chrome plated, polished stainless steel, anodized aluminum and bright aluminum treadplate. All buy out components, such as monitor, nozzle, gauges, etc. will be supplied as received from the vendor. Removable items such as brackets will be removed and painted separately to ensure paint coverage behind all mounted items. The stabilizer beams, pedestal and torque box (including water tank cradle) will be treated with epoxy E-coat prior to painting to help provide resistance to corrosion and chemicals. The stabilizers and torque box will be painted black. The aerial device components will be painted as follows using the aforementioned six (6) step finishing process: Aerial device ladder sections and extension cylinders: silver metallic 124 Aerial turntable: bright silver metallic 124 Aerial control console: silver metallic 124 Aerial lift cylinders: silver metallic 124 Aerial egress: #90 red (will be a contrasting color to the aerial device) Aerial boom support: gloss black primer 0544111 Reflective Band, 10"REFLECTIVE BAND A 10.00" black reflective band will be provided across the front of the vehicle and along the sides of the body. 67751Bid #: 0568574 Stripe, Reflective, Chevron, Front Bumper CHEVRON STRIPING ON THE FRONT BUMPER There will be alternating chevron striping located on the front bumper. The colors will be black and ruby red reflective. The size of the striping will be 6.00". 0624670 Stripe, Chevron, Rear, Diamond Grade, Aerial, Ascendant Single Axle REAR CHEVRON STRIPING There will be alternating chevron striping located on the rear-facing vertical surface of the apparatus. Covered surfaces will include the rear wall and aluminum doors. Roll up doors and stainless steel access doors will not be covered in chevron. The colors will be red and fluorescent yellow green diamond grade. Each stripe will be 6.00" in width. This will meet the requirements of the current edition of NFPA 1901, which states that 50% of the rear surface will be covered with chevron striping. 0598754 Stripe, Reflective/Diamond Grade, 4.00" on Stabilizers REFLECTIVE STRIPE ON STABILIZERS There will be a 4.00" wide fluorescent yellow green diamond grade reflective stripe provided on the forward and rear facing side of all aerial stabilizers. 0087342 Jog, "Z"-Shaped, In Reflective Stripe "Z" JOG IN REFLECTIVE STRIPE There will be one (1) "Z"-shaped jog(s) provided in the reflective stripe design. 0679883 Stripe, Printed Effect Gold Leaf Outline Above & Below Reflective Band PRINTED EFFECT GOLD LEAF STRIPE There will be a printed effect gold leaf stripe applied above and below the reflective band. The printed effect gold leaf stripes will be .50" wide with an outline. 0567374 Stripe, Black Outline each Chevron Stripe @ Rear (Not Warranted) REFLECTIVE STRIPE OUTLINE A black vinyl outline will be provided for each chevron stripe at the rear of the truck. 0667294 Stripe, Reflective, Chevron, Body Compt Door Edge, Diamond Grade DIAMOND GRADE CHEVRON STRIPE ON COMPARTMENT DOOR EDGE A fluorescent yellow green diamond grade and red diamond grade reflective stripe will be provided on the door edge of six (6) compartment doors. all doors. 0671595 Stripe, Diamond Grade Chevron, Swing Down Turntable Access Steps, Front and Rear DIAMOND GRADE CHEVRON STRIPE ON TURNTABLE ACCESS STEPS A fluorescent yellow green diamond grade and red diamond grade stripe will be provided on the front and rear sides of the swing down turn table access steps. one (1) step(s) will be striped. 0687353 SP Stripe, Black Outline each Chevron Stripe, Stabilizers, Four OUTLINE, REFLECTIVE STRIPE A black vinyl outline will be provided for each chevron stripe on the aerial stabilizers. 0512024 Stripe, Reflective, Chevron/Inverted "V", On Front Bumper CHEVRON/INVERTED "V" STRIPING ON THE FRONT BUMPER There will be alternating chevron striping located on the front bumper. The striping will consist of the following colors: The first color will be black The second color will be ruby red The size of the striping will be 6.00". 0552453 Stripe, Reflective, Chevron, Cab and Crew Cab Doors Interior, Diamond Grade INVERTED "V" CHEVRON STRIPING ON CAB AND CREW CAB DOORS There will be alternating chevron striping located on the inside of each cab and crew cab door. The striping will consist of the following colors: The first color will be red diamond grade The second color will be fluorescent yellow green diamond grade The size of the striping will be 4.00". 0679900 Stripe, Printed Effect Gold Leaf, Box, Boom Sign without Scrolls, Aerial BOOM SIGN STRIPING There will be printed effect gold leaf stripes along all edges of the aerial boom sign. 0027372 Lettering Specifications, (GOLD STAR Process) LETTERING The lettering will be totally encapsulated between two (2) layers of clear vinyl. 0685693 Lettering, Printed Effect Gold Leaf, 3.00", Each LETTERING There will be printed effect gold leaf lettering, 3.00" high, with outline and shade provided. There will be 17 letters provided. 68751Bid #: 0685525 Lettering, Printed Effect Gold Leaf, 12.00", Each LETTERING There will be printed effect gold leaf lettering, 12.00" high, with outline and shade provided. There will be nine (9) letters provided. 0685536 Lettering, Printed Effect Gold Leaf, 10.00", Each LETTERING There will be printed effect gold leaf lettering, 10.00" high, with outline and shade provided. There will be ten (10) letters provided. 0685544 Lettering, Printed Effect Gold Leaf, 8.00", Each LETTERING There will be printed effect gold leaf lettering, 8.00" high, with outline and shade provided. There will be eight (8) letters provided. 0685589 Lettering, Printed Effect Gold Leaf, 4.00", (21-40) LETTERING Twenty-one (21) to forty (40) printed effect gold leaf lettering, 4.00" high, with outline and shade will be provided. 0684055 Lettering, Vinyl, 3.00", Each LETTERING There will be non-reflective vinyl lettering, 3.00" high, with outline and shade provided. There will be 18 letters provided. 0614821 SP Emblem, Seal, Printed Effect Gold Leaf, 15"-17", Pair EMBLEM INSTALLATION There will be one (1) pair of department seals, comprised of printed effect gold leaf material, provided and installed on cab doors. 0772003 Manual, Fire Apparatus Parts, USB Flash Drive, Custom FIRE APPARATUS PARTS MANUAL There will be one (1) custom parts manual(s) in USB flash drive format for the complete fire apparatus provided. The manual(s) will contain the following: Job number Part numbers with full descriptions Table of contents Parts section sorted in functional groups reflecting a major system, component, or assembly Parts section sorted in alphabetical order Instructions on how to locate parts Each manual will be specifically written for the chassis and body model being purchased. It will not be a generic manual for a multitude of different chassis and bodies. SERVICE PARTS INTERNET SITE The service parts information included in these manuals are also available on the Pierce website. The website offers additional functions and features not contained in this manual, such as digital photographs and line drawings of select items. The website also features electronic search tools to assist in locating parts quickly. 0772037 Manual, Chassis Service, USB Flash Drive, Custom CHASSIS SERVICE MANUALS There will be one (1) chassis service manuals on USB flash drives containing parts and service information on major components provided with the completed unit. The manual will contain the following sections: Job number Table of contents Troubleshooting Front Axle/Suspension Brakes EngineTires Wheels Cab Electrical, DC Air Systems Plumbing Appendix The manual will be specifically written for the chassis model being purchased. It will not be a generic manual for a multitude of different chassis and bodies. 0773381 Manual, Chassis Operation, One (1) USB Flash Drive, Custom CHASSIS OPERATION MANUAL The chassis operation manual will be provided on one (1) USB flash drive. 0030008 Warranty, Basic, 1 Year, Apparatus, WA0008 ONE (1) YEAR MATERIAL AND WORKMANSHIP A Pierce basic apparatus limited warranty certificate, WA0008, is included with this proposal. 0611136 Warranty, Chassis, 3 Year, Velocity/Impel, WA0284 THREE (3) YEAR MATERIAL AND WORKMANSHIP The Pierce custom chassis limited warranty certificate, WA0284, is included with this proposal. 69751Bid #: 0696698 Warranty, Engine, Cummins, 5 Year, WA0181 ENGINE WARRANTY A Cummins five (5) year limited engine warranty will be provided. A limited warranty certificate, WA0181, is included with this proposal. 0684953 Warranty, Steering Gear, Sheppard M110, 3 Year WA0201 STEERING GEAR WARRANTY A Sheppard three (3) year limited steering gear warranty shall be provided. A copy of the warranty certificate shall be submitted with the bid package. 0595767 Warranty, Frame, 50 Year, Velocity/Impel, Dash CF, WA0038 FIFTY (50) YEAR STRUCTURAL INTEGRITY The Pierce custom chassis frame and crossmembers limited warranty certificate, WA0038, is included with this proposal. 0595698 Warranty, Axle, 3 Year, TAK-4, WA0050 FRONT AXLE THREE (3) YEAR MATERIAL AND WORKMANSHIP WARRANTY The Pierce TAK-4 suspension limited warranty certificate, WA0050, is included with this proposal. 0777368 Warranty, Axle, 2 Year, Meritor, General Service, WA0328 REAR AXLE TWO (2) YEAR MATERIAL AND WORKMANSHIP WARRANTY A Meritor axle limited warranty certificate, WA0046, is included with this proposal. 0652758 Warranty, ABS Brake System, 3 Year, Meritor Wabco, WA0232 ABS BRAKE SYSTEM THREE (3) YEAR MATERIAL AND WORKMANSHIP WARRANTY A Meritor Wabco™ABS brake system limited warranty certificate, WA0232, is included with this proposal. 0019914 Warranty, Structure, 10 Year, Custom Cab, WA0012 TEN (10) YEAR STRUCTURAL INTEGRITY The Pierce custom cab limited warranty certificate, WA0012, is included with this proposal. 0595813 Warranty, Paint, 10 Year, Cab, Pro- Rate, WA0055 TEN (10) YEAR PRO-RATED PAINT AND CORROSION A Pierce cab limited pro-rated paint warranty certificate, WA0055, is included with this proposal. 0524627 Warranty, Electronics, 5 Year, MUX, WA0014 FIVE (5) YEAR MATERIAL AND WORKMANSHIP The Pierce Command Zone electronics limited warranty certificate, WA0014, is included with this proposal. 0647720 Warranty, Pierce LED Strip Lights, WA0203 COMPARTMENT LIGHT WARRANTY The Pierce 12 volt DC LED strip lights limited warranty certificate, WA0203, is included with this proposal. 0046369 Warranty, 5-year EVS Transmission, Standard Custom, WA0187 TRANSMISSION WARRANTY The transmission will have a five (5) year/unlimited mileage warranty covering 100 percent parts and labor. The warranty will be provided by Allison Transmission. Note: The transmission cooler is not covered under any extended warranty you may be getting on your Allison Transmission. Please review your Allison Transmission warranty for coverage limitations. 0685945 Warranty, Transmission Cooler, WA0216 TRANSMISSION COOLER WARRANTY The transmission cooler will carry a five (5) year parts and labor warranty (exclusive to the transmission cooler). In addition, a collateral damage warranty will also be in effect for the first three (3) years of the warranty coverage and will not exceed $10,000 per occurrence. A copy of the warranty certificate will be submitted with the bid package. 0688798 Warranty, Water Tank, Lifetime, UPF, Poly Tank, WA0195 WATER TANK WARRANTY A UPF poly water tank limited warranty certificate, WA0195, is included with this proposal. 0596025 Warranty, Structure, 10 Year, Body, WA0009 TEN (10) YEAR STRUCTURAL INTEGRITY The Pierce apparatus body limited warranty certificate, WA0009, is included with this proposal. 0693127 Warranty, Gortite, Roll-up Door, 6 Year, WA0190 ROLL UP DOOR MATERIAL AND WORKMANSHIP WARRANTY A Gortite roll-up door limited warranty will be provided. The mechanical components of the roll-up door will be warranted against defects in material and workmanship for the lifetime of the vehicle. A six (6) year limited warranty will be provided on painted and satin roll up doors. The limited warranty certificate, WA0190, is included with this proposal. 70751Bid #: 0639211 Warranty, Pump, Hale, 5 Year Parts, 2 Year Labor, WA0248 PUMP WARRANTY A Hale pump limited warranty certificate, WA0248, is included with this proposal. . 0648675 Warranty, 10 Year S/S Pumbing, WA0035 TEN (10) YEAR PUMP PLUMBING WARRANTY The Pierce apparatus plumbing limited warranty certificate, WA0035, is included with this proposal. 0641372 Warranty, Foam System, Not Available 0006999 Warranty, Structure, 20 Year, Aerial Device, WA0052 TWENTY (20) YEAR AERIAL DEVICE STRUCTURAL INTEGRITY WARRANTY The Pierce device limited warranty certificate, WA0052, is included with this proposal. 0687388 Warranty, Swivels, 5 Year, Aerial Device, WA0197 AERIAL SWIVEL WARRANTY An Amity five (5) year limited swivel warranty will be provided. A copy of the warranty certificate will be submitted with the bid package. 0685727 Warranty, Hydraulic System and Components, 3 Year/5 Year, WA0200 HYDRAULIC SYSTEM COMPONENTS WARRANTY Aerial hydraulic system components will be provided with a five (5) year material and workmanship limited warranty. HYDRAULIC SEAL WARRANTY Aerial hydraulic seals will be provided with a three (3) year material and workmanship limited warranty. A copy of the warranty certificates will be submitted with the bid package. 0687327 Warranty, Waterway, 10 Year, Aerial Device, WA0198 AERIAL WATERWAY WARRANTY An Amity ten (10) year limited waterway warranty will be provided. A copy of the warranty certificate will be submitted with the bid package. 0595860 Warranty, Paint, 4 Year, Aerial Device, Pro-Rated, WA0047 FOUR (4) YEAR PRO-RATED PAINT AND CORROSION A Pierce aerial device limited pro-rated paint warranty certificate, WA0047, is included with this proposal. 0609981 Warranty, Harrison Generator, 6 Year, WA0285 SIX (6) YEAR GENERATOR MATERIAL AND WORKMANSHIP WARRANTY A Harrison Hydra-Gen limited warranty certificate, WA0285, is included with this proposal. 0595820 Warranty, Paint, 10 Year, Body, Pro- Rate, WA0057 TEN (10) YEAR PRO-RATED PAINT AND CORROSION A Pierce body limited pro-rated paint warranty certificate, WA0057, is included with this proposal. 0595421 Warranty, Goldstar, 3 Year, Apparatus, WA0018 THREE (3) YEAR MATERIAL AND WORKMANSHIP The Pierce Goldstar gold leaf lamination limited warranty limited warranty certificate, WA0018, is included with this proposal. 0683627 Certification, Vehicle Stability, CD0156 VEHICLE STABILITY CERTIFICATION The fire apparatus manufacturer will provide a certification stating the apparatus complies with NFPA 1901, current edition, section 4.13, Vehicle Stability. The certification will be provided at the time of bid. 0764540 Certification, Engine Installation, Velocity, Cummins X12, 2018 ENGINE INSTALLATION CERTIFICATION The fire apparatus manufacturer will provide a certification, along with a letter from the engine manufacturer stating they approve of the engine installation in the bidder's chassis. The certification will be provided at the time of delivery. 0686786 Certification, Power Steering, CD0098 POWER STEERING CERTIFICATION The fire apparatus manufacturer will provide a certification stating the power steering system as installed meets the requirements of the component supplier. The certification will be provided at the time of bid. 71751Bid #: 0667417 Certification, Cab Integrity, Velocity FR, CD0009 CAB INTEGRITY CERTIFICATION The fire apparatus manufacturer will provide a cab integrity certification with this proposal. The certification will state that the cab has been tested and certified by an independent third-party test facility. Testing events will be documented with photographs, real-time and high-speed video, vehicle accelerometers, cart accelerometers, and a laser speed trap. The fire apparatus manufacturer will provide a state-licensed professional engineer to witness and certify all testing events. Testing will meet or exceed the requirements below: European Occupant Protection Standard ECE Regulation No.29. SAE J2422 Cab Roof Strength Evaluation - Quasi-Static Loading Heavy Trucks. SAE J2420 COE Frontal Strength Evaluation - Dynamic Loading Heavy Trucks. Roof Crush The cab will be subjected to a roof crush force of 22,050 lb. This value meets the ECE 29 criteria and is equivalent to the front axle rating up to a maximum of 10 metric tons. Additional Roof Crush The same cab will be subjected to a roof crush force of 100,000 lbs. This value exceeds the ECE 29 criteria by nearly 4.5 times. Side Impact The same cab will be subjected to dynamic preload where a 13,275 lb moving barrier slams into the side of the cab at 5.5 mph at a force of 13,000 ft-lbs. This test is part of the SAE J2422 test procedure and more closely represents the forces a cab will see in a rollover incident. Frontal Impact The same cab will withstand a frontal impact of 32,600 ft-lbs of force using a moving barrier in accordance with SAE J2420. Additional Frontal Impact The same cab will withstand a frontal impact of 65,200 ft-lbs of force using a moving barrier, (twice the force required by SAE J2420). The same cab will withstand all tests without any measurable intrusion into the survival space of the occupant area. 0548950 Certification, Cab Door Durability, Velocity/Impel, CD0001 CAB DOOR DURABILITY CERTIFICATION Robust cab doors help protect occupants. Cab doors will survive a 200,000 cycle door slam test where the slamming force exceeds 20 G's of deceleration. The bidder will certify that the sample doors similar to those provided on the apparatus have been tested and have met these criteria without structural damage, latch malfunction, or significant component wear. 0548967 Certification, Windshield Wiper Durability, Impel/Velocity, CD0005 WINDSHIELD WIPER DURABILITY CERTIFICATION Visibility during inclement weather is essential to safe apparatus performance. Windshield wipers will survive a 3 million cycle durability test in accordance with section 6.2 of SAE J198 Windshield Wiper Systems - Trucks, Buses and Multipurpose Vehicles. The bidder will certify that the wiper system design has been tested and that the wiper system has met these criteria. 0667411 Certification, Electric Window Durability, Velocity/Impel FR, CD0004 ELECTRIC WINDOW DURABILITY CERTIFICATION Cab window roll-up systems can cause maintenance problems if not designed for long service life. The window regulator design will complete 30,000 complete up-down cycles and still function normally when finished. The bidder will certify that sample doors and windows similar to those provided on the apparatus have been tested and have met these criteria without malfunction or significant component wear. 0549273 Certification, Seat Belt Anchors and Mounting, Imp/Vel/Vel SLT, CD0018 SEAT BELT ANCHOR STRENGTH Seat belt attachment strength is regulated by Federal Motor Vehicle Safety Standards and should be validated through testing. Each seat belt anchor design will withstand 3000 lb of pull on both the lap and shoulder belt in accordance with FMVSS 571.210 Seat Belt Assembly Anchorages. The bidder will certify that each anchor design was pull tested to the required force and met the appropriate criteria. SEAT MOUNTING STRENGTH Seat attachment strength is regulated by Federal Motor Vehicle Safety Standards and should be validated through testing. Each seat mounting design will be tested to withstand 20 G's of force in accordance with FMVSS 571.207 Seating Systems. The bidder will certify that each seat mount and cab structure design was pull tested to the required force and met the appropriate criteria. 0667416 Certification, Cab Heater and Defroster, Velocity/Impel FR, CD0015 CAB DEFROSTER CERTIFICATION Visibility during inclement weather is essential to safe apparatus performance. The defroster system will clear the required windshield zones in accordance with SAE J381 Windshield Defrosting Systems Test Procedure And Performance Requirements - Trucks, Buses, And Multipurpose Vehicles.The bidder will certify that the defrost system design has been tested in a cold chamber and passes the SAE J381 criteria. CAB HEATER CERTIFICATION Good cab heat performance and regulation provides a more effective working environment for personnel, whether in-transit, or at a scene. The cab heaters will warm the cab 75 F from a cold- soak, within 30 minutes when tested using the coolant supply methods found in SAE J381. The bidder will certify that a substantially similar cab has been tested and has met these criteria. 72751Bid #: 0667415 Certification, Cab Air Conditioning Performance, Velocity/Impel FR, CD0016 CAB AIR CONDITIONING PERFORMANCE CERTIFICATION Good cab air conditioning temperature and air flow performance keeps occupants comfortable, reduces humidity, and provides a climate for recuperation while at the scene. The cab air conditioning system will cool the cab from a heat-soaked condition at 100 degrees Fahrenheit to an average of 67 degrees Fahrenheit in 30 minutes. The bidder will certify that a substantially similar air conditioning system has been tested and has met these criteria. The certification will be available at the time of delivery. 0545073 Amp Draw Report, NFPA Current Edition AMP DRAW REPORT The bidder will provide, at the time of bid and delivery, an itemized print out of the expected amp draw of the entire vehicle's electrical system. The manufacturer of the apparatus will provide the following: Documentation of the electrical system performance tests. A written load analysis, which will include the following: The nameplate rating of the alternator. The alternator rating under the conditions specified per: Applicable NFPA 1901 or 1906 (Current Edition). The minimum continuous load of each component that is specified per: Applicable NFPA 1901 or 1906 (Current Edition). Additional loads that, when added to the minimum continuous load, determine the total connected load. Each individual intermittent load. All of the above listed items will be provided by the bidder per the applicable NFPA 1901 or 1906 (Current Edition). 0002758 Amp Draw, NFPA/ULC Radio Allowance 0799248 Appleton/Florida BTO 0000049 Ascendant BODY 0000012 PIERCE CHASSIS 0004713 ENGINE, OTHER 0046396 EVS 4000 Series TRANSMISSION 0020012 HALE PUMP 0020009 POLY TANK 0028048 FOAM SYSTEM 0020006 SIDE CONTROL 0020007 AKRON VALVES 0020015 ABS SYSTEM 0658751 Manufacturing Attribute 73751Bid #: ! !"#$%& !"#' "# $#% # # (%)*% +,+ & # '%# -"(%(!"# #( .%/-"(%(!"#. %/* &(#",%/'" -"(%()( # ! # (#%# -"(%(!"#&& .-"(%( !"# (#" (#%0%. '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # + +(% #*( -+, (% #( .%/-"(%(!"#. %/* &(#",%/'"-"(%( )( # )&& % % ! $%#&# ! * &&# / %# !# /,## .# 0 ! # 1# #& (#%)# !# # ! % 0% -, 1 MEMORANDUM To: Mayor and City Council Through: Mike Land, City Manager From: Traci E. Leach, Deputy City Manager Date: November 13, 2018 Reference: Legislative Agenda 2030: Sense of Community, Special Place to Live, Business Prosperity, Sustainable City Government Introduction: The purpose of this agenda item is to discuss and finalize the City of Coppell’s legislative agenda for the upcoming legislative session, which begins in January 2019. The legislative agenda identifies priorities and issues for the City that will impact our community. This legislative platform will be provided to the elected officials that represent Coppell at the state level, as well as other decisionmakers and stakeholders throughout the state and here in Coppell. The backup material includes the legislative agenda document. The sections highlighted in yellow represent changes that were made after the most recent work session discussion on this item. Legal: None. Fiscal Impact:. None. Recommendation: Staff recommends approval of the Legislative Agenda for the 2019 legislative Session. 1 CITY OF COPPELL LEGISLATIVE PRIORITIES 2018 With Talking Points Local Control – The City of Coppell expressly opposes any measures that would limit, reduce, or remove the local control that municipalities have today regarding their respective abilities to govern, finance, or otherwise make decisions on behalf of the communities we serve. It is often said that the best government is that which is closest to the people. There is no level of government effort closer to the public than locally elected officials who represent municipalities and other local political subdivisions. What works for one municipality does not necessarily work in another. The locally elected mayors and city council members are best suited to make decisions on behalf of their respective communities. 1. Preemption of city regulation on numerous items is a red herring argument. 2. Cities have and do regulate many things that are municipal and specific to their respective community’s culture and desire. 3. Cities have not over-reached to regulate things they were not authorized to do. When proven otherwise, regulation is overturned without the need for bad legislation. 4. The “liberty” argument is hollow, particularly when voters appr ove measures they believe are in their best interest. 5. Voters are capable of speaking for themselves. Locally elected representatives know best what their respective communities desire. 6. Local decisions should be left to local representatives. 7. Get this one thing right and many of the other issues go away. Property Tax Caps– The City of Coppell opposes all efforts to implement ad valorem property tax caps. The well documented and undeniable property tax inequities that occur because of these types of measures alone should be reason enough to oppose this type of legislation. In addition, these types of measures that have been adopted in other states have severely limited the ability of municipalities and counties to maintain infrastructure, programs and services, the very things that the public expects from its government. Property tax caps have known unintended consequences that result in major inequities over time regarding the property taxes paid by different individuals in similarly situated homes. 1. Legislation already exists that empowers the citizens to limit the growth in taxes through time-tested truth-in-taxation and effective tax rate laws. 2. While nobody really likes property taxes, much of the tax revenue in growing and mature communities is used to operate and maintain facilities, roads, parks and services that were previously voter approved – it does no good to build the fire station and not staff it, no good to build the library and not equip it. 2 3. At the end of the day, locally elected Mayors and City Council Members listen to their citizens and know what is best for their respective communities. 4. Cities and counties are not the reason why property taxes are high in Texas. The reason is the WAY we fund schools. Cities and counties are about 20% each and the schools are approximately 60% depending upon where you live. Revenue Caps – The City of Coppell opposes any legislation or attempt to alter the manner in which municipalities in the State of Texas currently generate revenues or to require voter approval of revenue increases. Voter approval of the budget actions of the Mayor and City Council is accomplished each time a member of the Council seeks re-election. The above discussion regarding how this type of measure limits the ability to maintain needed infrastructure, programs and services applies to the issue. 1. Texas municipalities are already a major source of funding for the state. Cities and counties receive virtually no state funding. Texas is one of only two states that treats cities and counties in this manner. 2. Cities and counties are the economic generators for the state and if their ability to raise local revenue is capped they will not be able to offer tax abatements to attract new businesses into the state. When that happens, the Texas economy will begin to decline, and we will be just like every other state in this country. 3. Leave our revenues alone; we do not want to find ourselves in the same position as independent school districts in our state, that being underfunded. 4. The growth of revenues other than property taxes provides the opportunity to keep property taxes from rising. 5. Simple formulas that cap revenue growth on inflation and population growth do not work. The implementation of a major program, such as a new recreation facility, fire station, library, etc, often are much more expensive than the revenue growth from one year would fund based on the previous year’s population growth and inflation. 6. Any bill requiring voter approval of an increased level of revenue is fraught with problems due to the budget adoption cycle for Texas municipalities and the now limited number of dates that a municipality can hold an election. 7. At the end of the day any discussion regarding the belief that overall taxation in Texas is too high is failing to recognize that we have no income tax, something that we all agree is a bad addition to the tax revenue tool chest. Texas in fact has the 6th lowest overall tax burden in the entire country. 8. The Lieutenant Governor says its property tax reform. In truth, it would save the average homeowner about $2.00 a month. 9. The problem is SCHOOL TAXES. They are about 54% of a tax bill and if you are Chapter 41 school district like CISD local taxpayers send money to the State. The State has historically underfunded schools and they are trying to divert the attention from the real problem and make it someone else’s. 3 10. Not only would a lower rollback rate not produce significant property tax relief, the cumulative effect would be to reduce funding for everything the City provides. “Dark Store” Taxation – Big box stores have been challenging property tax assessments based on the “true cash value” which is significantly below the assessed value. Their argument is that the building was built for a sole function and has little value for other purposes. This is detrimental to local communities as well as to the State of Texas. We urge the state to expand the definition of special purpose properties to include retail buildings of greater than 50,000 sq. ft. to require assessments of value using the “cost method” not “comparable”. If a store is 10 years or less in age, “the sale of a comparable property may not be used in determining the assessment of the comparable property if it has been vacant for more than one year, has significant restriction on its use, was sold and is no longer used for its original purpose, or was not sold in an arm’s length transaction.” 1. This is another ploy used by large commercial property owners intending to lower the property tax on their respective properties. 2. Granting this type of evaluation model would severely lower taxable values which in turn would harm not only local taxing entities but also the state due to the school funding implications. 3. Various construction techniques can be applied to large commercial properties to subdivide a once large building into more than one commercial use. 4. The use of comparable properties should not be used to determine the taxable value given the very arguments being used by the industry; ie: their uses are so specialized Expenditure Limitations – The City of Coppell opposes an y legislation that would limit the elected Mayors and City Councils of Texas municipalities from adopting budgets that they deem appropriate for their respective communities or that would require voter approval for increases in expenditures. The City of Coppell employs a very open budgeting process during which there are multiple opportunities for the citizens to participate. Texas citizens are protected by the current truth-in- taxation and tax rate roll-back provisions. Once again, voter approval of the actions of the Mayor and City Council is accomplished each time they seek re-election. 1. Whenever the state passes along a mandate it causes local property taxes to go up. That is why the state per capita tax burden is so low. It is because the state passes along so much of the burden to the local governments. 2. Communities should be left to decide for themselves the level of funding they deem appropriate and they do this by participating in community visioning processes, budget processes, voting on capital improvements 3. Formulas that allow for the growth in debt service funding but not operations and maintenance funding to requisite levels to program and maintain the capital improvements are counterintuitive. Once again, it does no good to build it, even if voters 4 approve if the revenues that are necessary to operate and maintain the improvement are not available. 4. Any bill requiring voter approval of an increased level of expenditure is fraught with problems due to the budget adoption cycle for Texas municipalities and the now limited number of dates that a municipality can hold an election. Sales Tax Sourcing Legislation – The City of Coppell opposes any further changes in the sourcing of sales tax remittance from the current origin of sale method to any method that would include destination as the manner in which sales tax remittance is calculated. The City of Coppell participated in a compromise position developed by several cities in a previous legislative session that was ultimately adopted by the legislature regarding storefront sales verses warehouse sales. The City of Coppell has long had an economic development policy designed to attract business- to-business and warehouse users. The shift from origin to destination-based sales tax sourcing would result in the loss of millions of dollars in revenue annually from Coppell and send those dollars to municipalities that put forth no effort in the support of the very business that generated the tax. Several cities on both sides of this issue proposed compromise language during a previous legislative session that protects the business-to-business sales tax that is important to cities situated as we are while also protecting the sales tax generated at traditional storefronts that is important to other cities. This language was ultimately adopted by the legislature. This is a very confusing issue that potentially could lead to many unintended consequences. Most cities do not know what will actually happen to them if either sales tax sourcing in Texas is changed to destination-based from origin-based or the national Streamline Sales Tax Initiative is adopted. Streamline Sales Tax Initiative only makes sense if the United States Senate and House of Representatives actually pass legislation that dramatically alters the way in which internet sales are taxes. Do you really believe that any of those elected officials want to be known as the one’s that decided to “tax the internet.” In fact, they have been much more likely over the years to place a much longer-term moratorium on taxing the internet. Texas has long been an origin-based sales tax state. Cities have intentionally designed their economic development, community development, and other programs following current law. 1. Many communities, Coppell included, have revenue bond indebtedness that relies on current law and resulting revenues to make the debt service payments. The move to destination-based sales tax collection would devastate some and certainly harm all such cities. 2. The City of Coppell stands to lose between $4,000,000 and $9,000,000 annually if any of the changes are made as currently proposed. 5 Streamline Sales Tax Initiative - The City of Coppell opposes any attempt to adopt the Streamlined Sales Tax (SST) measure as has been discussed in past sessions unless the State of Texas maintains origin sourcing. The potential revenue the state would receive should Congress choose to tax the internet fully is just that, potential revenue. It remains to be seen whether the elected members of the House of Representatives will pass companion legislation to the Marketplace Fairness Act, legislation that is more favorable to origin-based sales tax states like Texas that has already been passed by the senate or offer different legislation that would enable full sales taxation of internet sales. Without that action, the state will not have access to appreciably more revenue from this sales tax source. Changing the sourcing laws prematurely in expectation of such a move at the federal level will only redistribute sales tax revenues from one Texas city to another. The compromise on retail storefront sourcing that was enacted several years ago should be given time to work. Before any additional measure are considered, a formal and thorough impact analysis should be conducted that fully discloses the impact that a broader SST adoption would have on the municipalities and other taxing jurisdictions, such as transit agencies. We have estimated that up to 20% of total General Fund and other revenues would be lost if a more comprehensive SST adoption like what has been discussed in recent years were to pass. 1. The State of Texas should pass legislations that allows municipalities to take advantage of the South Dakota vs Wayfair which requires sales tax be collected for online purchases. 2. Any legislation considered must keep Texas sales tax point of origin based. 3. See talking points above regarding sales tax sourcing. Education Funding – The City of Coppell supports efforts that would more adequately fund education from state revenue funds that would also decrease the amount of recapture currently required of districts such as the Coppell Independent School District. The percent of total state funding per pupil for public education has been continually decreasing. The legislature should turn attention to developing measures that would adequately fund education in our state, or at least fund education at historic levels. 1. While not a municipal issue on its face, the continued underfunding of public education is unacceptable. 2. The voucher issue takes even more money from public education under the guise of making it possible for the average citizen to choose private schools when the average person cannot afford private schools even with the voucher payment. 3. School choice wherein parents could choose to send their children to any school of their choice would over-run quality districts from a classroom space perspective while the State is funding an even less percentage of the total cost for those quality district to remain such. 4. Additional state funding for public education is necessary if true property tax relief is to be seen by property owners in Texas. 6 5. The state funding as a percent per pupil of the total continues to decline noticeably even though public education funding is one of 4 or 5 major issues the state should be doing. Transportation – The City of Coppell supports the Regional Transportation Council’s legislative agenda. Making real, meaningful progress on transportation initiatives is vital as our state continues to grow rapidly. More specifically, the DFW region continues to grow at a rate that is simply overwhelming the transportation system. The building of additional highway capacity is essential if the region is to continue to thrive as a very important economic engine for the entire State of Texas. Mass transit via rail must also become a reality in a much larger scale than currently exists as the continuation of sprawl becomes at some point unsustainable. This issue should be near the top of the priority list of items the requiring legislative attention. 1. The RTC and Rail North Texas initiatives are vital if the region is to maintain the economic generator status that the state needs from the north Texas area. 2. State funding for transportation projects in the Dallas/Ft. Worth area is vital. 3. Ensuring TxDot and NTTA perform as expected is important. Make them keep their promises. 4. Coppell supports regional rail initiatives, including the Cotton Belt DART line. 5. Fund projects with dollars as first intended. Do not co-mingle funds from one TxDot district with another unless the various stakeholders agree. 6. Support all tools necessary for successful construction of transportation projects including toll roads, tolled managed lanes, design build, concessions and any other financing avenues available. State Water Resources – The City of Coppell supports efforts to ensure a safe and dependable water supply for years to come. This is one of the most important issues for the legislature to resolve. Anticipated growth will certainly challenge the adequacy of current water resources. The City of Coppell opposes additional tap fees that would be collected by municipalities to be forwarded to the state as additional state revenue without providing a direct benefit to the citizens of the municipality in which the fee was collected. 1. This item SHOULD be on the agenda. Instead the legislature is worrying about issues of local control that are not broken. 2. The challenges facing Texas regarding future water needs are basic supply vs need 3. The work done in previous sessions did not actually fund any water supply or infrastructure Collective Bargaining – Oppose all efforts to mandate collective bargaining of any segment of municipal employees, be they public safety or otherwise. A “one size fits all” approach to labor management does not work. There is little doubt that the public safety and general quality of life our citizens enjoy will be harmed rather than enhanced by any mandated collective bargaining as municipalities will be forced to cut services, potentially 7 even public safety services, to cover the expected increases in costs that are always associated with the collective bargaining process and the resulting more expensive labor agreements. While our community wholeheartedly supports our public safety efforts, our citizens also enjoy the quality of life offerings that make our community what it is today. Forcing more and more expenditures to public safety efforts reduces the ability to maintain the overall quality of life our citizens now enjoy and demand. 1. We realize this will most likely be a mandate from the federal government, the arm of government most removed from the day-to-day lives of our citizens. 2. One size simply does not fit all. 3. There is no empirical evidence that suggests that the public is any better served by public safety organizations that have collective bargaining 4. There is plenty of empirical evidence that shows the costs of providing these services increases, often dramatically, when collective bargaining is imposed. 5. The increase in cost to provide the public safety services is almost always harms a municipalities ability to maintain other services at desired levels. 6. The State of Texas already has legislation that allows a community to adopt collective bargaining if the citizens want to do so. 7. The State of Texas should file suit against the federal government if they pass mandatory collective bargaining legislation. Alcoholic Beverage Sales – Oppose any further loosening of the restrictions regarding the proximity to schools, parks, and churches where alcoholic beverages can be sold. The community of Coppell has been built with families in mind. Our school system is one of the best in Texas. We have a very strong faith-based community and our municipal programs offer great kid-centric services to our families. Our ability to ensure safe and appropriate environments for these segments of our community is vital. 1. Leave these types of issues to the locally elected Councils to decide. 2. Current rules seem to be serving well. Oil and Gas Wells – Support any efforts that would provide municipalities more ability to control the site of oil and gas wells as they relate to residential developments, any occupied buildings, and environmental sensitive areas such as creeks, rivers and drainage ways. The proliferation of gas wells in the north Texas area has created concern regarding their proximity to residences, schools, parks, other occupied buildings and environmentally sensitive areas. The City of Coppell would support the expansion of our ability to apply greater distance requirements, noise mitigation standards and other control measures deemed necessary to protect our citizens from the problems caused by the gas exploration and production process. The associated air quality that has been well documented is also very important. 8 1. The exploration of the Barnett Shale in north Texas has led to much discussion regarding how communities can protect their citizens and business communities from the harmful effects of the drilling and operation of gas wells. 2. The rights of these companies to locate pipelines virtually any place they please is a frightening proposition. 3. Texas cities are to some degree severely hampered to regulate these activities due to current state law. 4. It appears that urban drilling was not contemplated when the legislation was passed. If it was contemplated, it was not done so effectively. Red Light Cameras – Continue to support the current legislation allowing a municipality to operate red light traffic cameras for the purposes of enhancing public safety at major intersections. The city of Coppell also encourages the state to utilize the funding it receives from Red Light Camera citations for the purposes for which it was collected by the state, that being Trauma funding. Otherwise, the state should cease collecting revenue from cities generated by this mechanism. 1. Despite testimony to the contrary, data does indicate that the number and severity of vehicle accidents taking place in intersections equipped with cameras has decreased. 2. This is not a revenue generator for Coppell. Year in, year out, total traffic citation revenue is very consistent in the 3%-4% range of total general fund revenues. 3. This has not changed substantially since red light cameras have been implemented. 4. Approximately 6% of violations are appealed. 5. Approximately 70% of appeals are upheld as valid violations. 6. Approximately 54% of all reviewed violations are eventually cited. The other 46% are not cited as being determined to be not an actual violation. Net neutrality – Internet service providers and governments regulating the Internet should treat all data on the Internet the same, not discriminating or charging differentially by user, content, website, platform, application, type of attached equipment, or mode of communication. Internet traffic includes all of the different messages, files and data sent over the Internet, including, for example, emails, digital audio files, digital video files, etc. Service network neutrality is the adherence to the paradigm that operation of a service at a certain layer is not influenced by any data other than the data interpreted at that layer, and in accordance with the protocol specification for that layer. 1. The rapid innovation that brought us e-mail, the World Wide Web, interactive online services, and e-commerce depends on an Internet that provides reliable and effective transport for all types of traffic. This critical innovation at the edges of the network will be stifled if network providers are allowed to block or degrade traffic in the middle. 2. The Internet was designed to be open and available to everyone, which is why it has been so powerful and successful. The Internet was not intended to be under the control of any one party; its value is that it can facilitate communications and the free flow of information around the world. "Tollbooths and gatekeepers are the 9 exact opposite of what the Internet is all about," said Michael J. Copps, a Democratic commissioner at the Federal Communications Commission. "Down that route consumers can count on paying more and getting less — less content, fewer services and reduced innovation." 3. Cable and telephone companies have the ability and incentive to skew Internet use toward their own services. They are supposed to be transparent carriers of broadband services, as noted by Vint Cerf in a letter to Congressmen Joe Barton and John Dingell on November 8, 2005: “Telephone companies cannot tell consumers who they can call; network operators should not dictate what people can do online.” Recently, however, a telephone company blocked its broadband customers from using VoIP telephone service because it could take revenue away from the company’s phone services; b. a cable company ordered consumers working from home to stop using their broadband connection to log into their employer’s virtual private network and tried to sell them a higher-priced alternative service; c. an Internet provider in Canada blocked access to a Web site run by the labor union involved in a dispute with the ISP; and d. the CEO of SBC told Business Week that companies such as Google, Yahoo, and Vonage would not be permitted to connect to SBC broadband customers without additional compensation to SBC.8 Drones - Support allowing local authorities to set local rules of use for unmanned vehicles, whether in the air, on the ground, or a combination of both. This would need to include specific locations where these vehicles would not be allowed to operate as well as areas where their use is encouraged. Autonomic Vehicles - support allowing local jurisdictions to regulate the use of self-driving, driverless, or autonomic vehicles on public thoroughfares. While the State of Texas has passed legislation to allow the use of such vehicles, local jurisdictions should be given the ability to regulate such vehicles within their jurisdictions. Power Grid Hardening - Oppose any attempt by the State to require hardening of the Texas power grid to protect it from EMP/EMC effects IF the costs of such hardening would be passed along to the consumer. (This would be an incredibly expensive undertaking and the current “plan” is to have the utility companies pass the cost along through rate increases) Smart Cities - Support the legislature in efforts to incentivize and recognize the importance of smart cities and the application of technology solutions through grants, awards, and other means. Texas should encourage the deployment of and assist whenever possible, cities efforts to modernize. The legislature must however recognize that there is no one size fits all solution as cities are ultimately responsible to their citizens desires. ! !"#$% !"& "# $#% # # '$ "(' )) & # '%# $"$ ($' "#$% "' *+"!,$ $+-"$.'%%'(* $+( "$($' " *$+'$ * $"$'"$+% "$ * /* '$' "$'"!* $+ $"$0" $+ '1'"!$+'$."!$ '!" ! # (#%# 2$**.% $"$+"!,*+'3'$ $"$*+'3'$ $"$ * '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # )4)'$ "(' -+, '$ "' *+"!,$ $+-"$.'%%'(* $+( "$($' " * $+'$ * $"$'"$+% "$ */* '$' "$'"!* $+ $"$0"$+ '1'"!$+'$."!$ '!" 2%% % % 5"'3'"$+&678$* $+'(+"! ! $%#&# / %# ! !# /,## 1 MEMORANDUM To: Mayor and City Council From: Vicki Chiavetta, Deputy City Manager Date: November 9, 2018 Reference: Coppell Arts Center – Consider approval of a Change Order to the Guaranteed Maximum Price for the construction of the City of Coppell Arts Center, in the amount of $1,781,925 and authorizing the City Manager to Sign. 2030: Sense of Community: Effective Community Partnerships Community Wellness and Enrichment: Community Gathering Places Expand Cultural Arts Amenities and Opportunities Sustainable City Government. Excellent City Services with High Level of Customer Satisfaction Excellent and Well-Maintained Infrastructure and Facilities Introduction: This action item is to consider the approval of a change order to the Guaranteed Maximum Price for the City of Coppell Arts Center. This change order includes enlarging the theater for additional seating, escalation costs for the original GMP and other associated costs. General Information Guaranteed Maximum Price with Alternate Approved on June 13, 2018 $ 16,253,089 Change Order #1 Cost $ 1,781,925 Analysis: On June 13, 2018, Council approved a Guaranteed Maximum Price for the City of Coppell Arts Center in the amount of $16,253,089. Subsequent discussion about the project revealed a desire by Council to increase the number of theater seats in the Arts Center. Staff were asked to obtain pricing 2 for the additional seating. Adding seating requires enlarging the theater and entails other costs as well. Early estimates for the additional seating were approximately $1,083,000. The proposed cost for the additional work is $1,781,925 and includes the seating, enlarged theater, and associated contingency. Also included are costs attributable to escalation due to the six-month delay of construction. If the Change Order #1 is approved, the total Project Cost would be as follows and includes the building cost (GMP), professional services fees, testing and inspections, furniture, fixtures and equipment, is $20,857,514. This does not include a separate owner’s contingency. Original Guaranteed Maximum Price $ 16,253,089 Change Order #1 Seats $ 1,781,925 Sub-Total GMP $ 18,035,014 FF&E $ 750,000 Testing $ 158,000 Tel, Tech, Utilities $ 288,000 Sub-Total $ 1,196,000 Total Construction $ 19,231,014 Professional Fees $ 1,626,500 Total Project $ 20,857,514 Legal Review: None required. Fiscal Impact: Funding for the additional GMP cost of $1,781,925 would be from the CRDC Special Revenue Fund. Recommendation: If Council chooses to move forward with Change Order #1 in the amount of $1,781,925, the City Manager’s Office proposes to fund it with the CRDC Special Revenue Fund. Should Council choose to not move forward with the additional seating, a separate Change Order will be brought forward at a later date to include escalation and unrealized value engineering costs to be funded by the CRDC Special Revenue Fund. GMP/Seat Estimate GMP/Actual Seat CostsConstruction GMP (June 2019) 15,934,506$ 15,934,506$ Accepted Parking Lot Alt. w/ GMP (June 2019) 318,583$ 318,583$ GMP SubTotal 16,253,089$ 16,253,089$ Added Seats (Estimate July, Actual Nov.) 1,083,000$ 1,781,925$ GMP/Seat Total 17,336,089$ 18,035,014$ 17,336,089$ (698,925)$ KǀĞƌĂŐĞĨŽƌĚĚĞĚ^ĞĂƚƐAdded City Comments 40,000$ Escalation 481,492$ Added Seats 1,260,433$ ŚĂŶŐĞKƌĚĞƌϭ &25(&216758&7,21 &,7<2)&233(//2/'72:1$576&(17(5 *8$5$17(('0$;,08035,&(352326$/ %,''$7( %/'*6) &2175$&7'85$7,21)RU,QV %RQG&RVW0R :$55$17<3(5,2'IRU,QV&RVW<HDUV %,' 3$&.$*( ,7(0 ,)&&267&2 $//2:$1&(6:,7+63(&,),&75$'(6 7851.(<&21&5(7( 7851.(<&21&5(7(&/$66 & 3$9(0(17,/2 $ $''67$03('3$9,1*$7 &5266:$/.65(%$5,/2$7$//'5,9(3$9,1*&233(//67''(7$,/6 $''(',1&/8'(' 32/,6+('&21&5(7( 0$6215<6721( '(/(7(7+,1%5,&.5(3/$&(:,7+3$,17(''5<:$//$,1&/8'(' 6758&785$/ 0,6&67((/)$% (5(&7:2$/80,180 6758&785$/67((/$//75$'(6$''(4373/$7)250/$1',1*6$1' *8$5'65(&21),*85(81'(5)/225$&&(66$''*$6.(7(''225 5(&21),*85(+$//&21752/$03(*5(665(&21),*85(&$7:$/. (*5(66:,7+67$,5 ,1&/8'(' '(&25$7,9(0(7$/$/80,180 ),1,6+('&$53(175<0,//:25. 528*+&$53(175< 522),1* :$7(53522),1* :$7(53522),1*87,/,=(0($'2:635(&216<67(0)25%(/2:*5$'( 6+((7:3$1'86(%$6)6<67(0)25)/8,'$33/,(':3,/263(&,),(' 6<67(0 [[[[ 635$<)2$0,168/$7,21 29(5+($''2256 '2256)5$0(6+$5':$5(/$% 0$7 */$66 */$=,1* '5<:$// '5<:$//3529,'(7 *:22'3/$1.6,/23/<:22'$73(5)+$// &$7:$/.6$1':22'3/$1.6$7%%&$7:$/.,/23/<:22' ,1&/8'(' '5<:$//5(029(',))86(:22',1+$//5(3/$&(:,7+3$,17(' '5<:$// '5<:$//7$5*(79$/8('(6,*15('8&7,21,1$&2867,&$/:$//3$1(/6 7,/( 5(6,/,(17)/225,1* :22')/225,1* 3$,17,1* *(1(5$/5(48,5(0(176 *(1(5$/2:1(55(48,5(0(1762:1(575$,/(5'521,1* 72,/(7$&&(6672,/(73$570,6&',963(& 6,*1$*( &$123,(6 Z 0(7$//2&.(56 :+((/&+$,5/,)7 7+($7(5(48,30(17 %8,/',1*0$,17(1$1&((437 :)) ( $33/,$1&(6 :)) ( 52//(56+$'(6 (175$1&(0$7 ),;('$8',(1&(6($7,1* )/$*32/(6 %,.(5$&.6 ),5(635,1./(5 3/80%,1* +9$& (/(&75,&$/ (/(&75,&$/ 7+($75(/,*+7,1*$'':$//:$6+(56$7 08/7,385326(505(029(/,*+76$79(67,%8/($''/,*+76$7 678',2$1'.,7&+(15(&21),*85(&21752/$03(*5(66 ,1&/8'(' (/(&75,&$/$'')/$*32/(/,*+765(&21),*85(&21752/$03 (*5(66&+$1*(.YD75$16)250(572.9$,1&/8'(' 86($/80)(('(56)25$1'/$5*(5)(('(56,/2&233(5 7$5*(79$/8('(6,*15('8&7,21,1/,*+7,1*6&23( ),5($/$50 6758&785('&$%/,1* $8',29,'(2 $8',29,'(2$''$9021,7256$7/281*($1'678',2 ,1&/8'(' $&&(66&21752/6<67(0 :)) ( &&796<67(0%8,/',1*,17586,21'(7(&7,21 ($57+:25. 7(50,7(75($70(17 0,6&6,7(,03529(0(176 3$9(0(170$5.,1*6 )(1&,1**$7(6 /$1'6&$3( ,55,*$7,21 )($7+(5*5$66 08+/<,/21:$''5('2$.6$1',55,*$7,21 /,5,23(,/2%(5(./(<6('*($'' //$1'6&$3,1*$1',55,*$7,21$662& :,7+3 =5($33529$/*5$9(/63(&3(5,)&,1&/8'(' 8VH&DIp5LYHU5RFNFREEOHJUDYHOLQOLHRRI&RORUDGR6DOW 3HSSHUFREEOHJUDYHO 8VH6PDOO1DWLYHFREEOHJUDYHOLQOLHXRI6LOYHUPLVWFREEOHJUDYHODQG 6,7(87,/,7,(6 6,7(87,/,7,(6)'&5(/2&$7(' /,1($''(',1&5($6(2))+/,1( 5('8&7,212)'20:$7(5/,1('5,/)25:$7(5 68%727$/6 68%%21'6&2175$&725'()$8/7,16 68%727$/ 52//,1*&2175$&725&21752//(',16 68%727$/ *(1(5$/&21',7,216 35(&216758&7,21)(( *(1(5$//,$ 80%5(//$,16 %8,/'(5 65,6.,1685$1&( %8,/',1*3(50,7 68%727$/ 2:1(5 6$//2:$1&( &217,1*(1&< 68%727$/ &25()(( ),1$/68%727$/ &25(3$<3(5)250%21' 727$/352326('$02817 ! !"#$% !"& "# $#% # # '$()$ *+* & # '%# , '"$%"$ "' '"$%"$$ $-'$. " %%'' " ! # (#%# '/ '$' "/" 0'%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # *1*'$ ")' -+, '$ "' '"$%"$$ $-'$. " %%'' " (%% % % ! $%#&# / %# !# /,## .# 0 # 1# #& (#%)# ! !# # ! % 0% -, THE FOLLOWING 2018 VACANCIES ARE AVAILABLE: ANIMAL SERVICES ADVISORY & APPEALS BOARD 1 Veterinarian (2-year term of office) ________________ BOARD OF ADJUSTMENT 3 Regular Members ________________ (2-year term of office) ________________ ________________ 1 Alternate Member ________________ (2-year term of office) COPPELL RECREATION DEVELOPMENT CORPORATION 7 Regular Members CC: Karen Hunt (2-year term of office) CC: Cliff Long ________________ ________________ ________________ ________________ ________________ COPPELL ECONOMIC DEVELOPMENT COMMITTEE 5 Regular Members _________________ (2-year term of office) _________________ _________________ _________________ LIBRARY BOARD 4 Regular Members _________________ (2-year term of office) _________________ _________________ _________________ LIBRARY BOARD - YOUTH ADVISOR 2 Students _________________ (1-year term of office) _________________ PARKS AND RECREATION BOARD 4 Regular Members _________________ (2-year term of office) _________________ _________________ _________________ 2 Alternate Members (2-year term of office) __________________ __________________ PARKS AND RECREATION BOARD – YOUTH ADVISOR 2 Students ___________________ (1-year term of office) ___________________ PLANNING AND ZONING COMMISSION 3 Regular Members ___________________ (2-year term of office) ___________________ ___________________ SPECIAL COUNSEL Minimum of 1 Regular Member ___________________ (2-year term of office) ___________________ ! !"#$%& !"#' "# $#% # # (% #)( ** & # '%# ' % #+) &(#"#% ' %,- .#% #) &(#"#% ! # (#%# '%)# (#%# *#+ #% (%, * -+, '%# $ $# !# '%#+ .& " # */*(% #)( -+, (% ' %,- .#% #) &(#"#% 0&& ! " !"#$%& #'( &&(%% ) % #$ %$& $ $ (% #'( ** ' $ (&$ &&(%) % ! +)"( #, -((% (%( # #'(&&-) # . #/%0(#(' #'(&&-/( ,% '%1(' #'(&&-, " $ )$&$ ! (&*$ )$&$ +$, ! $& )&- ! ! + .,- (&$ % %$ ! ! ! "$ ! (&$, /' # $ *2*(% #'( .,- (% ! +)"( #, -((% (%( # #'(&&-) # . #/%0(#(' #'(&&-/( ,% '%1(' #'(&&-, 1&& & & 3#%4('$&'%1%%&#%/5 " %&$'$ 3#%1%66)' &&#%( #/5 0 &$ !" "$ 0-$$ /$ 1 $ 2$ $' )$&*$ "$ $ " & 1& .-